Recombinant Mouse Anti-B. melitensis omp31 Antibody (A59/10F09/G1O) (CAT#: EPAF-1073LC)

This product is a mouse monoclonal antibody that specifically recognizes NAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFV, which is an linear epitope on 31 kDa outer-membrane protein from Brucella melitensis. The omp31-binding antibody A59/10F09/G1O is an epitope-specific antibody that can be used in western blotting.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Host Species
  • Mouse
  • Type
  • IgG2a
  • Specificity
  • Brucella melitensis 31 kDa outer-membrane protein
  • Species Reactivity
  • B. melitensis
  • Clone
  • A59/10F09/G1O
  • Applications
  • Western Blot

Target

  • Alternative Names
  • B. melitensis omp31; Brucella melitensis; B. melitensis; omp31; 31 kDa outer-membrane protein

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for EPAF-1073LC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare