Recombinant Mouse Anti-C. botulinum botE Antibody (EK21-4) (CAT#: EPAF-1271LC)

This product is a mouse monoclonal antibody that specifically recognizes LNSMVTDTLNNSIPFKLSSYTDDKILISYFNKFFKRIKSSSVLNMRYKNDKYVDTSGYDSNININGDVYKYPTNKNQFGIYNDKLSE, which is an linear epitope on Botulinum neurotoxin type E from Clostridium botulinum. The botE-binding antibody EK21-4 is an epitope-specific antibody that can be used in western blotting.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Host Species
  • Mouse
  • Specificity
  • Clostridium botulinum Botulinum neurotoxin type E
  • Species Reactivity
  • C. botulinum
  • Clone
  • EK21-4
  • Applications
  • Western Blot

Target

  • Alternative Names
  • C. botulinum botE; Clostridium botulinum; C. botulinum; botE; Botulinum neurotoxin type E

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "C. botulinum botE"

Select a product category from the dropdown menu below to view related products.
Please select product type
Epitope-Specific Antibody Products

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for EPAF-1271LC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare