1 0
Cart
    Inquiry
    Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

    Anti-Dog (Canine) Leptin Antibody (CAT#: MOB-0214MC)

    Polyclonal rabbit Antibody specifically binds to Dog (Canine) Leptin.

    Specific Inquiry
    • Size:

    • Conjugation:

    • Endotoxin:

    • Purity:

    • Formats:

    • Isotype Switching:

    • Fc Engineering:

    • Modalities:

    Custom Production

    We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

    Sequences:
    Isotype :
    Purity :
    Endotoxin :
    Quantity :
    Conjugation :
    Fc Engineering :
    Modalities :
    Other Requirements:
    We require custom production
    • Datasheet
    • MSDS
    • COA

    Specifications

    • Immunogen
    • MHWTLCFLWLWPLFAPIKDDTKTLIKTITRINDISHTS
    • Host Species
    • Rabbit
    • Species Reactivity
    • Bovine, Dog, oat, Horse, Human, Mouse, Rabbit, Rat, Sheep

    Product Property

    • Purification
    • Affinity Purified
    • Format
    • Lyophilized powder. Add 0 ul of distilled water. Final anti-LEP antibody concentration is 1 mg/ml in PBS buffer with 2 sucrose.
    • Concentration
    • 1.0 mg/ml
    • Buffer
    • For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
    • Storage
    • Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Target

    • Alternative Names
    • OB; OBS; LEPD

    Product Notes

    This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

    • Increased sensitivity
    • Confirmed specificity
    • High repeatability
    • Excellent batch-to-batch consistency
    • Sustainable supply
    • Animal-free production

    See more details about Hi-Affi™ recombinant antibody benefits.

    Downloads

    Download resources about recombinant antibody development and antibody engineering to boost your research.

    See other products for "Leptin"

    Select a product category from the dropdown menu below to view related products.
    Please select product type
    Chicken IgY Antibody Products Anti-Small Molecule Drug Antibody Products
    CAT Product Name Application Type
    BRD-1141MZ Chicken Anti-Rat Leptin Polyclonal IgY WB, ELISA Chicken antibody

    Customer Reviews and Q&As

    Submit a review or a question

    There are currently no Customer reviews or questions for MOB-0214MC. Click the button above to contact us or submit your feedback about this product.

    Popular products with customers

    Figure 1 Anti-Human Abeta Antibody in SDS-PAGE

    Anti-Human Abeta Recombinant Antibody (Solanezumab) (CAT# TAB-228)
    Application: WB, FuncS, IF, Neut, ELISA, FC, IP

    Figure 3 Anti-ERBB3 Recombinant Antibody (TAB-892) in DB

    Anti-Human ERBB3/ErbB 3 Recombinant Antibody (Seribantumab) (CAT# TAB-892)
    Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

    Figure 2 Anti-Human CD23 Recombinant Antibody (Gomiliximab) (TAB-231) in ELISA

    Anti-Human CD23 Recombinant Antibody (Gomiliximab) (CAT# TAB-231)
    Application: WB, Neut, ELISA, IF, IP, FuncS, FC

    Figure 3 Anti-Human EGFR Antibody (TAB-003) in DB

    Anti-Human EGFR Recombinant Antibody (Cetuximab) (CAT# TAB-003)
    Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

    Figure 4 Anti-Human IAV HA Recombinant Antibody (TAB-705)-Fc silenced in ELISA

    Anti-αvβ3 Integrin Recombinant Antibody (TAB-705) (CAT# TAB-705)
    Application: FC, IP, ELISA, Neut, FuncS, IF, IHC

    Figure 3 Anti-Human CD41 Recombinant Antibody (TP-100CL) in DB

    Abciximab (CAT# TP-100CL)
    Application:

    Figure 1 Mouse Anti-GD2 Recombinant Antibody (PABL-101) in SDS-PAGE

    Mouse Anti-GD2 Recombinant Antibody (clone 3F8) (CAT# PABL-101)
    Application: FC, ELISA, FuncS

    Figure 2 Recombinant Mouse Anti-B. burgdorferi OspA Antibody (PABZ-012) in HPLC

    Recombinant Mouse Anti-B. burgdorferi OspA Antibody ( LA-2) (CAT# PABZ-012)
    Application: Neut, WB

    Figure 2 Anti-C3b Antibody (PABL-420) in HPLC

    Human Anti-C3b Recombinant Antibody (clone S77) (CAT# PABL-420)
    Application: FuncS, Inhib, IP, ELISA

    Figure 2 Anti-Human SLC34A2 Recombinant Antibody (TAB-467MZ) in HPLC

    Mouse Anti-SLC34A2 Recombinant Antibody (TAB-467MZ) (CAT# TAB-467MZ)
    Application: FC, Inhib

    Figure 2 Recombinant Human Anti-EGFR Antibody (PABX-052) in HPLC

    Recombinant Human Anti-EGFR Antibody (PABX-052) (CAT# PABX-052)
    Application: WB, ELISA, FuncS, IB, FC, SPR, Apop

    Figure 2 Mouse Anti-ERBB2 Recombinant Antibody (NEUT-737CQ) in HPLC

    Mouse Anti-ERBB2 Recombinant Antibody (clone 7.16.4) (CAT# NEUT-737CQ)
    Application: Block, IP, IF, FC

    Figure 3 Human Anti-Human ERBB3 Antibody (TAB-422CQ) in DB

    Anti-Human ERBB3 Recombinant Antibody (TAB-422CQ) (CAT# TAB-422CQ)
    Application: ELISA, IHC, FC, IP, IF, BL

    Figure 1 Anti-Human RSPO3 Recombinant Antibody (TAB-449CQ) in SDS-PAGE

    Anti-Human RSPO3 Recombinant Antibody (Rosmantuzumab) (CAT# TAB-449CQ)
    Application: ELISA, IHC, FC, IP, IF, FuncS

    Figure 3 Anti-Human F3 Antibody (TAB-473CQ) in ELISA

    Anti-Human F3 Recombinant Antibody (TAB-473CQ) (CAT# TAB-473CQ)
    Application: ELISA, IHC, FC, IP, IF, Inhib

    Figure 3 Rat Anti-IL18 Recombinant Antibody (HPAB-0067-YC-S(P)) in ELISA

    Rat Anti-IL18 Recombinant Antibody (clone 2C10); scFv Fragment (CAT# HPAB-0067-YC-S(P))
    Application: Neut

    Figure 2 Mouse Anti-TREM2 Recombinant Antibody (HPAB-0154-CN) in HPLC

    Mouse Anti-TREM2 Recombinant Antibody (HPAB-0154-CN) (CAT# HPAB-0154-CN)
    Application: WB, ELISA, FC, IHC, IF, IP

    Figure 5 Human Anti-FGFR2 Recombinant Antibody (NS-027CN) in Dot Blot

    Human Anti-FGFR2 Recombinant Antibody (clone M048-D01) (CAT# NS-027CN)
    Application: ELISA, WB, FC

    Figure 4 Recombinant Mouse Anti-RSV F Antibody (PABC-276) in WB

    Recombinant Mouse Anti-RSV F Antibody (PABC-276) (CAT# PABC-276)
    Application: ELISA, Neut, DB, FC

    Figure 2 Anti-SLC39A6 Antibody in ELISA.

    Recombinant Mouse Anti-SLC39A6 Antibody (1.7A4) (CAT# MOB-382CQ)
    Application: ELISA, WB

    For Research Use Only. Not For Clinical Use.

    Send Inquiry

    This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

    Go to compare

    Go to compare