Anti-Dog (Canine) Leptin Antibody (CAT#: MOB-0214MC)

Polyclonal rabbit Antibody specifically binds to Dog (Canine) Leptin.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • MHWTLCFLWLWPLFAPIKDDTKTLIKTITRINDISHTS
  • Host Species
  • Rabbit
  • Species Reactivity
  • Bovine, Dog, oat, Horse, Human, Mouse, Rabbit, Rat, Sheep

Product Property

  • Purification
  • Affinity Purified
  • Format
  • Lyophilized powder. Add 0 ul of distilled water. Final anti-LEP antibody concentration is 1 mg/ml in PBS buffer with 2 sucrose.
  • Concentration
  • 1.0 mg/ml
  • Buffer
  • For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
  • Storage
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Target

  • Alternative Names
  • OB; OBS; LEPD

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Leptin"

Select a product category from the dropdown menu below to view related products.
Please select product type
Chicken IgY Antibody Products Anti-Small Molecule Drug Antibody Products
CAT Product Name Application Type
BRD-1141MZ Chicken Anti-Rat Leptin Polyclonal IgY WB, ELISA Chicken antibody

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MOB-0214MC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare