
Anti-Human TM4SF5 Antibody (CBMAB-0350MC)

Polyclonal Rabbit Antibody against Human TM4SF5.      

This antibody was developed against Recombinant Protein corresponding to amino acids:GLRNGPRCLMNGEWGYHFEDTAGAYLLNRTLWDRCEAPPRVVPWNVTL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Species Reactivity
Alternative Names
TM4SF5; transmembrane 4 L six family member 5
Entrez Gene ID
UniProt ID

For lab research use only, not for diagnostic, therapeutic or any in vivo human use.

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us
Send Inquiry Now!
* Phone:
* E-mail Address:
* Service & Products Interested:
Project Description:
* Verification Code:
Please input "biolabs"(case insensitive) as verification code.
Contact Us to Order
Tel: 1-631-381-2994
Fax: 1-631-207-8356

45-1 Ramsey Road, Shirley, NY 11967, USA     Tel: 1-631-381-2994    Fax: 1-631-207-8356    Email:
Terms of Service-Privacy Policy     © 2007 - 2018 Creative-Biolabs All Rights Reserved