Human Anti-MIEN1 Recombinant Antibody (clone MAb163)

CAT#: HPAB-0013CQ

MAb 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the monoclonal antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).

Gene Expression
Figure 1 IF staining of human cell line OE19 Figure 2 IHC staining of human testis Figure 3 Colon Figure 4 Liver Figure 5 Kidney Figure 6 Testis Figure 7 RNA cell line category: Group enriched (OE19, SK-BR-3)

Specifications

  • Host Species
  • Human
  • Derivation
  • Human
  • Type
  • Human IgG1, κ
  • Specificity
  • Human MIEN1
  • Species Reactivity
  • Human
  • Clone
  • MAb163
  • Applications
  • ELISA, WB, IF
  • Related Disease
  • Cancers

Product Property

  • Purity
  • >95% as determined by SDS-PAGE and HPLC analysis
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • C35; ORB3; XTP4; RDX12; C17orf37
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-0013CQ. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

Protocol & Troubleshooting

We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.

See other products for "Clone MAb163"

See other products for "MIEN1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
TAB-1340CL Anti-Human MIEN1 Recombinant Antibody (1B2) ELISA
CAT Product Name Application Type
HPAB-0010CQ Human Anti-MIEN1 Recombinant Antibody (clone MAb165) ELISA, WB, IF Human IgG1, κ
HPAB-0011CQ Human Anti-MIEN1 Recombinant Antibody (clone MAb171) ELISA, WB, IF Human IgG1, κ
HPAB-0012CQ Human Anti-MIEN1 Recombinant Antibody (clone MAbc009) ELISA, WB, IF Human IgG1, κ
CAT Product Name Application Type
VS-1024-XY549 Mouse Anti-NHP MIEN1 Recombinant Antibody (clone OTI2D2) WB, IHC, FC Mouse IgG1
CAT Product Name Application Type
VS-0525-XY4392 Anti-MIEN1 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare