Human Anti-MIEN1 Recombinant Antibody (clone MAb163) (CAT#: HPAB-0013CQ)
MAb 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the monoclonal antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).
Specific Inquiry
Custom Production
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
We require custom production
Subcellular Location and Protein Expression
Normal Tissue
RNA Expression
Figure 1 IF staining of human cell line OE19
(Immunofluorescent staining of human cell line OE19 shows localization to plasma membrane & cytosol.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/56650/1971_G6_5_selected.jpg
(Immunofluorescent staining of human cell line OE19 shows localization to plasma membrane & cytosol.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/56650/1971_G6_5_selected.jpg
Figure 2 IHC staining of human testis
(Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/ihc_selected.jpg
(Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/ihc_selected.jpg
Figure 3 Colon
(Glandular cells
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_3.jpg
(Glandular cells
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_3.jpg
Figure 4 Liver
(Hepatocytes
Staining: Low
Intensity: Weak
Quantity: 75%-25%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_4.jpg
(Hepatocytes
Staining: Low
Intensity: Weak
Quantity: 75%-25%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_4.jpg
Figure 5 Kidney
(Cells in tubules
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_5.jpg
(Cells in tubules
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_8_5.jpg
Figure 6 Testis
(Cells in seminiferous ducts
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous
Leydig cells
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_6_6.jpg
(Cells in seminiferous ducts
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous
Leydig cells
Staining: Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/61344/140064_A_6_6.jpg
Figure 7 RNA cell line category: Group enriched (OE19, SK-BR-3)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000141741-MIEN1
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000141741-MIEN1
Specifications
- Host Species
- Human
- Derivation
- Human
- Type
- Human IgG1, κ
- Specificity
- Human MIEN1
- Species Reactivity
- Human
- Clone
- MAb163
- Applications
- ELISA, WB, IF
- Related Disease
- Cancers
Product Property
- Purity
- >95% as determined by SDS-PAGE and HPLC analysis
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone MAb163"
See other products for "MIEN1"
Select a product category from the dropdown menu below to view related products.
Please select product type
IgM Antibody Products
Mouse Antibody Products
Rabbit Monoclonal Antibody Products
IgG Antibody Products
ScFv Antibody Products
Fab Antibody Products
Non-Human Primate (NHP) Antibody Products
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1340CL | Anti-Human MIEN1 Recombinant Antibody (1B2) | ELISA |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-0013CQ. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, ELISA, FC, IP, FuncS, IF, Neut
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: WB, ELISA, FuncS
Application: Neut, ELISA, Inhib, ICC, WB
![Figure 2 Anti-Human CD19 Recombinant Antibody Fab Fragment [TAB-1611CL-F(E)] in HPLC](https://img.creativebiolabs.net/productimages/COA-TAB-1611CL-F(E)-2.png)
Application: Depletion, FuncS
Application: ELISA, WB, FC, IHC, IP
Application: ELISA, FC, IHC, Neut
Application: ELISA, FC, FuncS
Application: ELISA, Vaccine, FuncS
For Research Use Only. Not For Clinical Use.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
