Human Anti-MIEN1 Recombinant Antibody (clone MAb163); scFv Fragment
CAT#: HPAB-0013CQ-S(P)
scFv 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the scFv antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).







Specifications
- Host Species
- Human
- Derivation
- Human
- Type
- Human scFv
- Specificity
- Human MIEN1
- Species Reactivity
- Human
- Clone
- MAb163
- Applications
- ELISA, WB, IF
- Related Disease
- Cancers
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for HPAB-0013CQ-S(P). Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "Clone MAb163"
- CAT
- Product Name
See other products for "MIEN1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-1340CL | Anti-Human MIEN1 Recombinant Antibody (1B2) | ELISA |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-1341CL | Anti-Human MIEN1 Recombinant Antibody (1B3) | ELISA | |
TAB-1342CL | Anti-Human MIEN1 Recombinant Antibody (1F2) | ELISA | |
TAB-1343CL | Anti-Human MIEN1 Recombinant Antibody (3E 9) | ELISA | |
TAB-1344CL | Anti-Human MIEN1 Recombinant Antibody (3E 10) | ELISA | |
TAB-1345CL | Anti-Human MIEN1 Recombinant Antibody (KC5) | ELISA |
CAT | Product Name | Application | Type |
---|---|---|---|
MOR-2233 | Hi-Affi™ Recombinant Rabbit Anti-MIEN1 Monoclonal Antibody (DS2233AB) | WB | IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAb165) | ELISA, WB, IF | Human IgG1, κ |
HPAB-0011CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAb171) | ELISA, WB, IF | Human IgG1, κ |
HPAB-0012CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009) | ELISA, WB, IF | Human IgG1, κ |
HPAB-0013CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAb163) | ELISA, WB, IF | Human IgG1, κ |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAb165); scFv Fragment | ELISA, WB, IF | Human scFv |
HPAB-0011CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAb171); scFv Fragment | ELISA, WB, IF | Human scFv |
HPAB-0012CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009); scFv Fragment | ELISA, WB, IF | Human scFv |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb165); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0011CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb171); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0012CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0013CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb163); Fab Fragment | ELISA, WB, IF | Human Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
VS-1024-XY549 | Mouse Anti-NHP MIEN1 Recombinant Antibody (clone OTI2D2) | WB, IHC, FC | Mouse IgG1 |
CAT | Product Name | Application | Type |
---|---|---|---|
VS-0525-XY4392 | Anti-MIEN1 Immunohistochemistry Kit | IHC |
Popular Products
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: WB, ELISA, FuncS
Application: IB, ELISA, FC, FuncS
Application: WB, ELISA, FC, IHC, IP
Application: FC, IB, Block, Inhib, FuncS, ELISA, FACS, IP, IF
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, FC, Inhib, FuncS
Application: Neut
Application: ELISA, Vaccine, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.