Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0131-CN-F(E)) (CAT#: HPAB-0131-CN-F(E))

This product is a recombinant rabbit antibody Fab fragment that recognizes MZB1. This antibody can mediate the inhibition of PACAP38-driven cAMP production via VPAC2-R-expressing CHO-K1 cells.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
  • Host Species
  • Rabbit
  • Type
  • Rabbit Fab
  • Specificity
  • Human MZB1
  • Species Reactivity
  • Human
  • Applications
  • ELISA, FC

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • PACAP; pERp1; MEDA-7

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "MZB1"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products Fab Antibody Products ScFv Antibody Products Rabbit Monoclonal Antibody Products Antibody Magnetic Beads IHC Kit and Antibody Products: Precision Tools for Immunohistochemistry

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-0131-CN-F(E). Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare