Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0131-CN-F(E)) (CAT#: HPAB-0131-CN-F(E))
This product is a recombinant rabbit antibody Fab fragment that recognizes MZB1. This antibody can mediate the inhibition of PACAP38-driven cAMP production via VPAC2-R-expressing CHO-K1 cells.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line REH shows localization to the Golgi apparatus.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/52694/2006_D6_1_selected.jpg

* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_3_7_val_selected.jpg

(Enterocytes - Mucosal lymphoid cells Staining: Medium Intensity: Strong Quantity: <25%)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_9_3.jpg

(Germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_7_8.jpg

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000170476-MZB1
Specifications
- Immunogen
- Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
- Host Species
- Rabbit
- Type
- Rabbit Fab
- Specificity
- Human MZB1
- Species Reactivity
- Human
- Applications
- ELISA, FC
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "MZB1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-1539z | Rabbit Anti-MZB1 Recombinant Antibody (MOB-1539z) | WB | Rabbit IgG |
HPAB-0131-CN | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0131-CN) | ELISA, FC | Rabbit IgG |
HPAB-0132-CN | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0132-CN) | ELISA, FC | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-0131-CN-F(E). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: ELISA, Neut, IF, IP, FC, FuncS
Application: FuncS, IF, Neut, ELISA, FC, IP, WB
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: IB, ELISA, FC, FuncS
Application: ELISA, IHC, FC, IP, IF, Inhib
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.