Mouse Anti-OMP Antibody (2B7)
CAT#: MOB-022CS
This product is a mouse antibody which is specific for OMP. It can be used for various applications such as ELISA, WB.

Specifications
- Immunogen
- Partial recombinant OMP (Sequence:FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL)
- Host Species
- Mouse
- Type
- Mouse IgG2a, κ
- Species Reactivity
- Human
- Clone
- 2B7
- Applications
- Used for immunoassay techniques such as: Enzyme-linked immunosorbent assay; Western Blot
Product Property
- Purity
- >95% as determined by analysis by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration
- Storage
- Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Target
Customer Review
There are currently no Customer reviews or questions for MOB-022CS. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "OMP"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-1272z | Mouse Anti-OMP Recombinant Antibody (clone 19B10) | WB, IP, IF, IHC, ELISA | Mouse IgG2a, κ |
VS3-FY1808 | Rabbit Anti-Omp Recombinant Antibody (clone R07-4I2) | WB, IP | Rabbit IgG |
Popular Products
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: ELISA, IP, FC, FuncS, Neut, IF, WB
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, WB
Application: Neut, Inhib, FC, ELISA
Application: FC, FRET, Internalization
Application: ELISA, FC, IF, WB
Application: ELISA, FuncS, Neut, IF, WB, EM, Inhib, IHC
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.