Mouse Anti-OMP Antibody (2B7) (CAT#: MOB-022CS)

This product is a mouse antibody which is specific for OMP. It can be used for various applications such as ELISA, WB.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
RNA Expression

Specifications

  • Immunogen
  • Partial recombinant OMP (Sequence:FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL)
  • Host Species
  • Mouse
  • Type
  • Mouse IgG2a, κ
  • Species Reactivity
  • Human
  • Clone
  • 2B7
  • Applications
  • Used for immunoassay techniques such as: Enzyme-linked immunosorbent assay; Western Blot

Product Property

  • Purity
  • >95% as determined by analysis by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration
  • Storage
  • Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.

Target

  • Alternative Names
  • OMP; olfactory marker protein

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "OMP"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products
CAT Product Name Application Type
MOB-1272z Mouse Anti-OMP Recombinant Antibody (clone 19B10) WB, IP, IF, IHC, ELISA Mouse IgG2a, κ
VS3-FY1808 Rabbit Anti-Omp Recombinant Antibody (clone R07-4I2) WB, IP Rabbit IgG

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MOB-022CS. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare