Rabbit Anti- Human SMIM1 Polyclonal Antibody (CAT#: MOB-0422ZL)

Rabbit polyclonal antibody specifically binds to human SMIM1 antibody

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • A recombinant protein (Sequence:QPQESHVHYSRWEDGSRGVSLGAVSSTEEASRCRRISQRLCTGKLD)
  • Host Species
  • Rabbit
  • Species Reactivity
  • Human

Product Property

  • Purity
  • Immunogen affinity purified
  • Format
  • Liquid
  • Concentration
  • Concentrations vary lot to lot. See vial label for concentration
  • Buffer
  • PBS and 40% glycerol (pH 7.2)
  • Preservative
  • 0.02% Sodium Azide
  • Storage
  • Store at 4°C short term. For extended storage aliquot and store at -20°C or below. Avoid freeze-thaw cycles.

Target

  • Alternative Names
  • Vel; Vel Blood Group Antigen; Small Integral Membrane Protein 1 (Vel Blood Group); Small Integral Membrane Protein 1

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "SMIM1"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products
CAT Product Name Application Type
MOB-0423ZL Recombinant Human SMIM1 Peptide Neut

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for MOB-0422ZL. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare