Rabbit Anti- Human SMIM1 Polyclonal Antibody (CAT#: MOB-0422ZL)
Rabbit polyclonal antibody specifically binds to human SMIM1 antibody
Specific Inquiry
Normal Tissue
RNA Expression
Figure 1 Cerebral cortex
(Neuronal cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Nuclear Neuropil Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150710_B_8_5.jpg
(Neuronal cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Nuclear Neuropil Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150710_B_8_5.jpg
Figure 2 Colon
(Glandular cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_7_3.jpg
(Glandular cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_7_3.jpg
Figure 3 Kidney
(Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_8_5.jpg
(Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_8_5.jpg
Figure 4 High expression in testis
(Elongated or late spermatids Staining: High Intensity: Strong Quantity:>75% Leydig cells Staining: Low Intensity: Weak Quantity:>75% Pachytene spermatocytes Staining: High Intensity: Strong Quantity:>75% Preleptotene spermatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Round or early spermatids Staining: High Intensity: Strong Quantity:>75%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_6_6.jpg
(Elongated or late spermatids Staining: High Intensity: Strong Quantity:>75% Leydig cells Staining: Low Intensity: Weak Quantity:>75% Pachytene spermatocytes Staining: High Intensity: Strong Quantity:>75% Preleptotene spermatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Round or early spermatids Staining: High Intensity: Strong Quantity:>75%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_6_6.jpg
Figure 5 Seminal vesicle
(Glandular cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_8_6.jpg
(Glandular cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/69088/150561_A_8_6.jpg
Figure 6 RNA cell line category: Group enriched (HEL, Hep G2, K-562)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000235169-SMIM1
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000235169-SMIM1
Specifications
- Immunogen
- A recombinant protein (Sequence:QPQESHVHYSRWEDGSRGVSLGAVSSTEEASRCRRISQRLCTGKLD)
- Host Species
- Rabbit
- Species Reactivity
- Human
Product Property
- Purity
- Immunogen affinity purified
- Format
- Liquid
- Concentration
- Concentrations vary lot to lot. See vial label for concentration
- Buffer
- PBS and 40% glycerol (pH 7.2)
- Preservative
- 0.02% Sodium Azide
- Storage
- Store at 4°C short term. For extended storage aliquot and store at -20°C or below. Avoid freeze-thaw cycles.
Target
- Alternative Names
- Vel; Vel Blood Group Antigen; Small Integral Membrane Protein 1 (Vel Blood Group); Small Integral Membrane Protein 1
- Gene ID
- 388588
- UniProt ID
- B2RUZ4
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "SMIM1"
Recombinant Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0423ZL | Recombinant Human SMIM1 Peptide | Neut |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MOB-0422ZL. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.