Rabbit Anti- Human SMIM1 Polyclonal Antibody
CAT#: MOB-0422ZL
Rabbit polyclonal antibody specifically binds to human SMIM1 antibody






Specifications
- Immunogen
- A recombinant protein (Sequence:QPQESHVHYSRWEDGSRGVSLGAVSSTEEASRCRRISQRLCTGKLD)
- Host Species
- Rabbit
- Species Reactivity
- Human
Product Property
- Purity
- Immunogen affinity purified
- Format
- Liquid
- Concentration
- Concentrations vary lot to lot. See vial label for concentration
- Buffer
- PBS and 40% glycerol (pH 7.2)
- Preservative
- 0.02% Sodium Azide
- Storage
- Store at 4°C short term. For extended storage aliquot and store at -20°C or below. Avoid freeze-thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for MOB-0422ZL. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "SMIM1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-0423ZL | Recombinant Human SMIM1 Peptide | Neut |
Popular Products
Application: WB, IF, IP, Neut, FuncS, ELISA, FC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: WB, ELISA, FC, IP, FuncS, IF, Neut
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: IP, IF, FuncS, FC, Neut, ELISA, IHC
Application: WB, IHC, ELISA, FC
Application: WB, FC, IF, Inhib, ELISA, IHC
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.