Rabbit Anti-Abcc8 Recombinant Antibody (VS-0522-LC43) (CAT#: VS-0522-LC43)
This product is a rabbit antibody that recognizes Abcc8 protein of Hamster, rat, mouse.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & the Golgi apparatus.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/if_selected.jpg

(Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_B_9_6_selected.jpg

(Germinal center cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_8_8.jpg

(Neuronal cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_B_7_5.jpg

(Glandular cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous Peripheral nerve/ganglion Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_9_3.jpg

(Exocrine glandular cells Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous Pancreatic endocrine cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/11451/26292_A_1_3.jpg

(Cells in glomeruli Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_7_5.jpg

(Cells in seminiferous ducts Staining: High Intensity: Strong Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/42318/92429_A_6_6.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000006071-ABCC8
Specifications
- Immunogen
- A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
- Host Species
- Rabbit
- Type
- Rabbit IgG
- Specificity
- Rat Abcc8
- Species Reactivity
- Hamster, Rat, Mouse
- Applications
- WB
- Conjugate
- Unconjugated
- Related Disease
- Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced
Product Property
- Purification
- Protein A purified
- Format
- Liquid
- Concentration
- 1 mg/ml
- Buffer
- PBS
- Preservative
- 0.02% Proclin 300
- Storage
- Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.
Applications
- Application Notes
- This antibody has been tested for use in Western Blot.
Target
- Alternative Names
- Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1
- Gene ID
- 25559
- UniProt ID
- Q09429
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "ABCC8"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-2653z | Mouse Anti-ABCC8 Recombinant Antibody (clone 25H8) | WB, ELISA, IP | Mouse IgG2a, κ |
MOB-1992CT | Mouse Anti-ABCC8 Recombinant Antibody (clone EML1649) | WB | Mouse IgG2a |
VS-0522-LC41 | Mouse Anti-Abcc8 Recombinant Antibody (VS-0522-LC41) | WB | Mouse IgG2a |
VS-0522-LC42 | Rat Anti-Abcc8 Recombinant Antibody (VS-0522-LC42) | WB | Rat IgG2b |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for VS-0522-LC43. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: Neut, ELISA, IF, IP, FuncS, FC, WB
Application: ELISA, FuncS, IHC, IF, FC, ADCC
Application: ELISA, FC, IF, WB
Application: ELISA, FC, Inhib, FuncS
Application: ELISA, FC, Neut, Inhib
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.