Rabbit Anti-Abcc8 Recombinant Antibody (VS-0522-LC43)

CAT#: VS-0522-LC43

This product is a rabbit antibody that recognizes Abcc8 protein of Hamster, rat, mouse.

Gene Expression
Figure 1 IF staining of human cell line U-2 OS Figure 2 IHC staining of human hippocampus Figure 3 Lymph node Figure 4 Cerebral cortex Figure 5 Colon Figure 6 Pancreas Figure 7 Kidney Figure 8 Testis Figure 9 RNA cell line category: Group enriched (A549, AN3-CA, SCLC-21H)

Specifications

  • Immunogen
  • A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8.
  • Host Species
  • Rabbit
  • Type
  • Rabbit IgG
  • Specificity
  • Rat Abcc8
  • Species Reactivity
  • Hamster, Rat, Mouse
  • Applications
  • WB
  • Conjugate
  • Unconjugated
  • Related Disease
  • Hyperinsulinemic Hypoglycemia, Familial, 1 and Hypoglycemia, Leucine-Induced

Product Property

  • Purification
  • Protein A purified
  • Format
  • Liquid
  • Concentration
  • 1 mg/ml
  • Buffer
  • PBS
  • Preservative
  • 0.02% Proclin 300
  • Storage
  • Store at 4°C for short term. For long term storage, store at-20°C, avoiding freeze/thaw cycles.

Applications

  • Application Notes
  • This antibody has been tested for use in Western Blot.

Target

  • Alternative Names
  • Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for VS-0522-LC43. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "ABCC8"

Select a product category from the dropdown menu below to view related products.

Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare