Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-AP313-YC-F(E)) (CAT#: HPAB-AP313-YC-F(E))
This product is a recombinant human antibody Fab fragment that recognizes CXCR3. The antibody was purified by affinity chromatography. The binding kinetic (KD) of the full length anti-CXCR3 antibody was evaluated to be 16.0 nM.
Specific Inquiry
Custom Production
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
We require custom production
Normal Tissue
RNA Expression
Figure 1 Colon
(Enterocytes - Mucosal lymphoid cells Staining: High Intensity: Strong Quantity: 75%-25%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_3.jpg
(Enterocytes - Mucosal lymphoid cells Staining: High Intensity: Strong Quantity: 75%-25%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_3.jpg
Figure 2 Liver
(Hepatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_7_4.jpg
(Hepatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_7_4.jpg
Figure 3 Testis
(Leydig cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_5_6.jpg
(Leydig cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_5_6.jpg
Figure 4 High expression in lymph node
(Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_8.jpg
(Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_8.jpg
Figure 5 RNA cell line category: Cell line enriched (RPMI-8226)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000186810-CXCR3
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000186810-CXCR3
Specifications
- Immunogen
- An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
- Host Species
- Human
- Derivation
- Humanized (mouse/human)
- Type
- Humanized Fab
- Specificity
- Human CXCR3
- Species Reactivity
- Human
- Applications
- FC, Inhib
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen
- Gene ID
- 2833
- UniProt ID
- P49682
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "CXCR3"
Select a product category from the dropdown menu below to view related products.
Please select product type
Immunotoxin Products
Human Antibody Products
Mouse Antibody Products
Humanized Antibody Products
IgG Antibody Products
Blocking Antibody Products
Neutralizing Antibody Products
Rabbit Monoclonal Antibody Products
Fab Antibody Products
ScFv Antibody Products
Flow Cytometry (FC) related Reagents and Kits: Empowering Cell Function Research
Extracellular Vesicle (EV) Antibody Products
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-L073D | IP10-DT immunotoxin | Cytotoxicity assay, Functional assay |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-AP313-YC-F(E). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: FC, IP, ELISA, Neut, FuncS, IF, WB
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
-5.jpg)
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
-2.png)
Application: ELISA
Application: ELISA, FuncS
For Research Use Only. Not For Clinical Use.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
