Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-AP320-YC-F(E)) (CAT#: HPAB-AP320-YC-F(E))
This product is a recombinant human antibody Fab fragment that recognizes CXCR3. The antibody was purified by affinity chromatography. The binding kinetic (KD) of the full length anti-CXCR3 antibody was evaluated to be 0.349 nM.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Enterocytes - Mucosal lymphoid cells Staining: High Intensity: Strong Quantity: 75%-25%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_3.jpg

(Hepatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_7_4.jpg

(Leydig cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_5_6.jpg

(Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_8.jpg

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000186810-CXCR3
Specifications
- Immunogen
- An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
- Host Species
- Human
- Derivation
- Humanized (mouse/human)
- Type
- Humanized Fab
- Specificity
- Human CXCR3
- Species Reactivity
- Human
- Applications
- FC, Inhib
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen
- Gene ID
- 2833
- UniProt ID
- P49682
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "CXCR3"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
AGTO-L073D | IP10-DT immunotoxin | Cytotoxicity assay, Functional assay |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-AP320-YC-F(E). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, FuncS, IF, Neut, ELISA, FC, IP
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: ELISA
Application: ELISA, FC
Application: ELISA, PD, Activ, PK, Stim
Application: WB, FC, IF, Inhib, ELISA, IHC
Application: ELISA, WB
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.