Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-AP322-YC-F(E))
CAT#: HPAB-AP322-YC-F(E)
This product is a recombinant human antibody Fab fragment that recognizes CXCR3. The antibody was purified by affinity chromatography.
Specifications
- Immunogen
- An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
- Host Species
- Human
- Derivation
- Chimeric (mouse/human)
- Type
- Chimeric (mouse/human) Fab
- Specificity
- Human CXCR3
- Species Reactivity
- Human
- Applications
- FC, Inhib
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for HPAB-AP322-YC-F(E). Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "CXCR3"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-L073D | IP10-DT immunotoxin | Cytotoxicity assay, Functional assay |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-125MZ | Human Anti-CXCR3 Recombinant Antibody (TAB-125MZ) | FC | Human IgG |
| TAB-126MZ | Human Anti-CXCR3 Recombinant Antibody (TAB-126MZ) | FC | Human IgG |
| TAB-134MZ | Human Anti-CXCR3 Recombinant Antibody (TAB-134MZ) | FuncS, Inhib | Human IgG2, κ |
| TAB-135MZ | Human Anti-CXCR3 Recombinant Antibody (TAB-135MZ) | FuncS | Human IgG2, κ |
| TAB-125MZ-F(E) | Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (TAB-125MZ-F(E)) | FC | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-127MZ | Mouse Anti-CXCR3 Recombinant Antibody (TAB-127MZ) | FC, FuncS | Mouse IgG |
| TAB-129MZ | Mouse Anti-CXCR3 Recombinant Antibody (TAB-129MZ) | Inhib | Mouse IgG |
| TAB-130MZ | Mouse Anti-CXCR3 Recombinant Antibody (TAB-130MZ) | Inhib | Mouse IgG |
| TAB-131MZ | Mouse Anti-CXCR3 Recombinant Antibody (TAB-131MZ) | Inhib | Mouse IgG |
| TAB-132MZ | Mouse Anti-CXCR3 Recombinant Antibody (TAB-132MZ) | Inhib | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-136MZ | Anti-Human CXCR3 Recombinant Antibody (Ab1) | Inhib | Humanized antibody |
| TAB-137MZ | Anti-Human CXCR3 Recombinant Antibody (Ab2) | Inhib | Humanized antibody |
| TAB-138MZ | Anti-Human CXCR3 Recombinant Antibody (Ab3) | FC, Binding and chemotaxis assay | Humanized antibody |
| TAB-139MZ | Anti-Human CXCR3 Recombinant Antibody (Ab4) | FC, Binding and chemotaxis assay | Humanized antibody |
| TAB-140MZ | Anti-Human CXCR3 Recombinant Antibody (Ab5) | FC, Binding and chemotaxis assay | Humanized antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-678CQ | Mouse Anti-CXCR3 Recombinant Antibody (clone G025H7) | FC, Block | Mouse IgG1, κ |
| NEUT-683CQ | Hamster Anti-Cxcr3 Recombinant Antibody (clone CXCR3-173) | FC, Block | Hamster IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-679CQ | Mouse Anti-CXCR3 Recombinant Antibody (clone 2Ar1) | ICC, IF, IHC-P, IHC-Fr, Neut, FC | Mouse IgG1 |
| NEUT-680CQ | Mouse Anti-CXCR3 Recombinant Antibody (clone CBL045) | FC, IHC, Neut | Mouse IgG1 |
| NEUT-681CQ | Mouse Anti-CXCR3 Recombinant Antibody (clone CBL794) | FC, IHC, CyTOF®, Neut | Mouse IgG1 |
| NEUT-682CQ | Mouse Anti-CXCR3 Recombinant Antibody (clone MM0223-7K22) | IHC-Fr, Neut, FC | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0888 | Hi-Affi™ Rabbit Anti-CXCR3 Recombinant Antibody (clone DS888AB) | WB, ICC, IF, IP | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0378-YC | Mouse Anti-CXCR3 Recombinant Antibody (HPAB-0378-YC) | FC | Mouse IgG |
| HPAB-0379-YC | Mouse Anti-CXCR3 Recombinant Antibody (HPAB-0379-YC) | ELISA, FC, FuncS | Mouse IgG |
| HPAB-0380-YC | Mouse Anti-CXCR3 Recombinant Antibody (HPAB-0380-YC) | ELISA, FC, FuncS | Mouse IgG |
| HPAB-AP312-YC | Human Anti-CXCR3 Recombinant Antibody (HPAB-AP312-YC) | FC, Inhib | Chimeric (mouse/human) IgG |
| HPAB-AP313-YC | Human Anti-CXCR3 Recombinant Antibody (HPAB-AP313-YC) | FC, Inhib | Humanized IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0378-YC-S(P) | Mouse Anti-CXCR3 Recombinant Antibody; scFv Fragment (HPAB-0378-YC-S(P)) | FC | Mouse scFv |
| HPAB-0379-YC-S(P) | Mouse Anti-CXCR3 Recombinant Antibody; scFv Fragment (HPAB-0379-YC-S(P)) | ELISA, FC, FuncS | Mouse scFv |
| HPAB-0380-YC-S(P) | Mouse Anti-CXCR3 Recombinant Antibody; scFv Fragment (HPAB-0380-YC-S(P)) | ELISA, FC, FuncS | Mouse scFv |
| HPAB-N0344-YC-S(P) | Human Anti-CXCR3 Recombinant Antibody; scFv Fragment (53hu37) | FuncS | Humanized scFv |
| HPAB-AP312-YC-S(P) | Mouse Anti-CXCR3 Recombinant Antibody; scFv Fragment (HPAB-AP312-YC-S(P)) | FC, Inhib | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0378-YC-F(E) | Mouse Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-0378-YC-F(E)) | FC | Mouse Fab |
| HPAB-0379-YC-F(E) | Mouse Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-0379-YC-F(E)) | ELISA, FC, FuncS | Mouse Fab |
| HPAB-0380-YC-F(E) | Mouse Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-0380-YC-F(E)) | ELISA, FC, FuncS | Mouse Fab |
| HPAB-N0344-YC-F(E) | Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (53hu37) | FuncS | Humanized Fab |
| HPAB-AP312-YC-F(E) | Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (HPAB-AP312-YC-F(E)) | FC, Inhib | Chimeric (mouse/human) Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS13-YC277 | CytoStream™ Mouse Anti-CXCR3 Recombinant Antibody (VS13-YC277) | FC | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC497 | Recombinant Anti-CXCR3 Vesicular Antibody, EV Displayed (VS-0425-YC497) | ELISA, FC, Inhib, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY1824 | Anti-CXCR3 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-YC38 | Recombinant Anti-CXCR3 (AA 1-15 x AA 16-30) Biparatopic Antibody, Tandem scFv (Clone 1C6 x Clone 4B4) | ELISA, FC | Tandem scFv |
Popular Products

Application: WB, ELISA, IP, FC, FuncS, Neut, IF

Application: FC, IP, ELISA, Neut, FuncS, IF, IHC

Application: ELISA, Neut, IF, IP, FC, FuncS

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, WB

Application: FuncS, Inhib, IP, ELISA

Application: ELISA, Activ, Block
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.















