Human Anti-CXCR3 Recombinant Antibody (HPAB-AP315-YC)

CAT#: HPAB-AP315-YC

This product is a recombinant human antibody that recognizes CXCR3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.

Gene Expression
Figure 1 Colon Figure 2 Liver Figure 3 Testis Figure 4 High expression in lymph node Figure 5 RNA cell line category: Cell line enriched (RPMI-8226)

Specifications

  • Immunogen
  • An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
  • Host Species
  • Human
  • Derivation
  • Chimeric (mouse/human)
  • Type
  • Chimeric (mouse/human) IgG
  • Specificity
  • Human CXCR3
  • Species Reactivity
  • Human
  • Applications
  • FC, Inhib

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP315-YC. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "CXCR3"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
AGTO-L073D IP10-DT immunotoxin Cytotoxicity assay, Functional assay
CAT Product Name Application Type
TAB-128MZ-F(E) Human Anti-CXCR3 Recombinant Antibody; Fab Fragment (TAB-128MZ-F(E)) FC Humanized Fab
TAB-136MZ-F(E) Anti-Human CXCR3 Recombinant Antibody Fab Fragment (Ab1) FC, Binding and chemotaxis assay Humanized antibody
TAB-137MZ-F(E) Anti-Human CXCR3 Recombinant Antibody Fab Fragment (Ab2) FC, Binding and chemotaxis assay Humanized antibody
TAB-138MZ-F(E) Anti-Human CXCR3 Recombinant Antibody Fab Fragment (Ab3) FC, Binding and chemotaxis assay Humanized antibody
TAB-139MZ-F(E) Anti-Human CXCR3 Recombinant Antibody Fab Fragment (Ab4) FC, Binding and chemotaxis assay Humanized antibody
CAT Product Name Application Type
NEUT-678CQ Mouse Anti-CXCR3 Recombinant Antibody (clone G025H7) FC, Block Mouse IgG1, κ
NEUT-683CQ Hamster Anti-Cxcr3 Recombinant Antibody (clone CXCR3-173) FC, Block Hamster IgG
CAT Product Name Application Type
NEUT-679CQ Mouse Anti-CXCR3 Recombinant Antibody (clone 2Ar1) ICC, IF, IHC-P, IHC-Fr, Neut, FC Mouse IgG1
NEUT-680CQ Mouse Anti-CXCR3 Recombinant Antibody (clone CBL045) FC, IHC, Neut Mouse IgG1
NEUT-681CQ Mouse Anti-CXCR3 Recombinant Antibody (clone CBL794) FC, IHC, CyTOF®, Neut Mouse IgG1
NEUT-682CQ Mouse Anti-CXCR3 Recombinant Antibody (clone MM0223-7K22) IHC-Fr, Neut, FC Mouse IgG1
CAT Product Name Application Type
MOR-0888 Hi-Affi™ Rabbit Anti-CXCR3 Recombinant Antibody (clone DS888AB) WB, ICC, IF, IP Rabbit IgG
CAT Product Name Application Type
VS13-YC277 CytoStream™ Mouse Anti-CXCR3 Recombinant Antibody (VS13-YC277) FC Mouse IgG1
CAT Product Name Application Type
VS-0425-YC497 Recombinant Anti-CXCR3 Vesicular Antibody, EV Displayed (VS-0425-YC497) ELISA, FC, Inhib, Cell-uptake
CAT Product Name Application Type
VS-0525-XY1824 Anti-CXCR3 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare