Human Anti-CXCR3 Recombinant Antibody (HPAB-AP320-YC) (CAT#: HPAB-AP320-YC)

This product is a recombinant human antibody that recognizes CXCR3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography. The binding kinetic (KD) of the anti-CXCR3 antibody was evaluated to be 0.349 nM.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Formats:
  • Isotype Switching:
  • Fc Engineering:
  • Modalities:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
  • Host Species
  • Human
  • Derivation
  • Humanized (mouse/human)
  • Type
  • Humanized IgG
  • Specificity
  • Human CXCR3
  • Species Reactivity
  • Human
  • Applications
  • FC, Inhib

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "CXCR3"

Select a product category from the dropdown menu below to view related products.
Please select product type
Immunotoxin Products Human Antibody Products Mouse Antibody Products Humanized Antibody Products IgG Antibody Products Blocking Antibody Products Neutralizing Antibody Products Rabbit Monoclonal Antibody Products ScFv Antibody Products Fab Antibody Products
CAT Product Name Application Type
AGTO-L073D IP10-DT immunotoxin Cytotoxicity assay, Functional assay

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP320-YC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

  • 0
  • 0
Cart
    Go to compare

    Go to compare