Human Anti-CXCR3 Recombinant Antibody (HPAB-AP325-YC) (CAT#: HPAB-AP325-YC)
This product is a recombinant human antibody that recognizes CXCR3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Enterocytes - Mucosal lymphoid cells Staining: High Intensity: Strong Quantity: 75%-25%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_3.jpg

(Hepatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_7_4.jpg

(Leydig cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_5_6.jpg

(Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/45942/139633_A_8_8.jpg

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000186810-CXCR3
Specifications
- Immunogen
- An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
- Host Species
- Human
- Derivation
- Chimeric (mouse/human)
- Type
- Chimeric (mouse/human) IgG
- Specificity
- Human CXCR3
- Species Reactivity
- Human
- Applications
- FC, Inhib
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen
- Gene ID
- 2833
- UniProt ID
- P49682
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "CXCR3"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
AGTO-L073D | IP10-DT immunotoxin | Cytotoxicity assay, Functional assay |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-AP325-YC. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: FC, IP, ELISA, Neut, FuncS, IF, WB
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, Neut, FuncS
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.