This product is a recombinant mouse antibody that recognizes Mucin1. This monoclonal antibody was generated to MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography. It was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-A2-1 was tested by fluorescence-activated cell sorting (FACS) for its ability to bind to MUC1 on intact cells.
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Download resources about recombinant antibody development and antibody engineering to boost your research.
CAT | Product Name | Application | Type |
---|---|---|---|
NAB-2049-VHH | Recombinant Anti-human MUC1 VHH Single Domain Antibody | WB, IP, ChiP, Neut, ELISA | Llama VHH |
HPAB-AP504-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (5-24) | FC | Camel VHH |
HPAB-AP505-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (aMUC1) | ELISA | Camel VHH |
HPAB-0736-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (ER46) | ELISA | Camelid VHH |
HPAB-0737-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (AR-32) | ELISA | Camelid VHH |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-H56 | Anti-Human MUC1 Recombinant Antibody (Pemtumomab) | WB, FuncS, IF, Neut, ELISA, FC, IP | IgG |
TAB-765 | Mouse Anti-MUC1 Recombinant Antibody (clone Nacolomab); Fab Fragment | FC, IP, ELISA, Neut, FuncS, IF, ICC | Mouse Fab (IgG1, κ) |
TAB-0388CL | Mouse Anti-Human MUC1 Recombinant Antibody | WB, IHC | |
TAB-0388CL-S(P) | Mouse Anti-Human MUC1 Recombinant Antibody scFv Fragment | WB, IHC | |
TAB-411MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-411MZ) | ELISA | Mouse IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
AGTO-L036E | anti-MUC1 immunotoxin C242 (Fab)-PE | Cytotoxicity assay, Functional assay | |
AGTO-L064E | anti-MUC1 immunotoxin H23 (scFv)-PE | Cytotoxicity assay, Functional assay |
CAT | Product Name | Application | Type |
---|---|---|---|
PABL-662 | Mouse Anti-MUC1 Recombinant Antibody | WB, IF, FuncS | Mouse IgG |
MOB-124CQ | Mouse Anti-Human MUC1 Antibody | IHC, IF | Mouse IgG1, κ |
HPAB-0495-FY | Human Anti-MUC1 Recombinant Antibody (HPAB-0495-FY) | ELISA, WB, IP | Human IgE |
HPAB-0496-FY | Human Anti-MUC1 Recombinant Antibody (HPAB-0496-FY) | ELISA, IHC | Human IgE |
HPAB-AP739-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP739-YC) | ELISA | Mouse IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-0278CL | Human Anti-MUC1 Recombinant Antibody (TAB-0278CL) | ELISA, Internalization, BI, FuncS | Human IgG |
TAB-0278CL-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-0278CL-S(P)) | ELISA, Internalization, BI, FuncS | Human scFv |
TAB-0278CL-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-0278CL-F(E)) | ELISA, Internalization, BI, FuncS | Human Fab |
TAB-431MZ-F(E) | Anti-Human MUC1 Recombinant Antibody Fab Fragment (PH1) | ELISA, WB, FC, IHC | Human antibody |
TAB-432MZ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-432MZ-F(E)) | ELISA, FC | Human Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-412MZ | Human Anti-MUC1 Recombinant Antibody (TAB-412MZ) | ELISA | Chimeric (mouse/human) IgG |
TAB-412MZ-S(P) | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-412MZ-S(P)) | ELISA | Mouse scFv |
TAB-412MZ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-412MZ-F(E)) | ELISA | Chimeric (mouse/human) Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-413MZ | Human Anti-MUC1 Recombinant Antibody (TAB-413MZ) | ELISA | Humanized IgG |
TAB-425MZ | Anti-Human MUC1 Recombinant Antibody (huDMB5F3) | ELISA, FC, FuncS, ICC | Humanized antibody |
TAB-413MZ-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-413MZ-S(P)) | ELISA | Humanized scFv |
TAB-425MZ-S(P) | Anti-Human MUC1 Recombinant Antibody scFv Fragment (huDMB5F3) | FC | Humanized antibody |
TAB-430MZ-S(P) | Anti-Human MUC1 Recombinant Antibody scFv Fragment (BLC595) | ELISA, FC | Humanized antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
Gly-012LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
Gly-120LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) | ELISA | Mouse antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
Gly-012LC-1 | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
Gly-109LC | Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) | ELISA | Human antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
Gly-121LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
Gly-122LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
Gly-123LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
Gly-124LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
BRD-0379MZ | Chicken Anti-MUC1 Polyclonal IgY | IHC, WB | Chicken antibody |
CAT | Product Name | Application | Type |
---|---|---|---|
MOR-2320 | Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) | IHC-P, IHC-Fr | IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
EPAF-0838LC | Recombinant Mouse Anti-Human MUC1 Antibody (SM3) | ELISA | IgG1 |
EPAF-0581CQ | Recombinant Mouse Anti-Human MUC1 Antibody (B27.29) | Neut, FC | IgG1 |
EPAF-0583CQ | Recombinant Mouse Anti-Human MUC1 Antibody (BC4E549) | Neut, FC | IgG1 |
EPAF-0584CQ | Recombinant Mouse Anti-Human MUC1 Antibody (DF3) | Neut, FC | IgG1 |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0091-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-0091-YC-S(P)) | ELISA, Neut | Mouse scFv |
HPAB-0094-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone 12D10); scFv Fragment | ELISA, FC | Mouse scFv |
PSBC-399 | Mouse Anti-MUC1 Recombinant Antibody (clone AR20.5); scFv Fragment | ELISA, FC, FuncS | Mouse scFv |
PSBC-400 | Mouse Anti-MUC1 Recombinant Antibody (clone SM3); scFv Fragment | FC, IHC-Fr, IF, ELISA, IHC-P | Mouse scFv |
HPAB-0495-FY-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-0495-FY-S(P)) | ELISA | Human scFv |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0272CQ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0272CQ-F(E)) | ELISA, FC, FuncS | Human Fab |
HPAB-0872LY-F(E) | Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0872LY-F(E)) | ELISA, WB, FC | Mouse Fab |
HPAB-0873LY-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0873LY-F(E)) | ELISA, WB, FC | Humanized Fab |
HPAB-0874LY-F(E) | Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0874LY-F(E)) | ELISA, WB, FC | Mouse Fab |
HPAB-0875LY-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0875LY-F(E)) | ELISA, WB, FC | Humanized Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
AFC-TAB-H56 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Pemtumomab), ADCC Enhanced | FuncS, IF, Neut, ELISA, FC | ADCC enhanced antibody |
AFC-TAB-H65 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Sontuzumab), ADCC Enhanced | ELISA, FC, IP, FuncS, IF | ADCC enhanced antibody |
AFC-TAB-026ML | Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Gatipotuzumab), ADCC Enhanced | ELISA, IHC, FC, IP, IF, FuncS | ADCC enhanced antibody |
AFC-TAB-166 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody (Cantuzumab), ADCC Enhanced | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
AFC-TAB-H77 | Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) | ELISA, FC, IP, FuncS, IF | IgG1, κ |
There are currently no Customer reviews or questions for HPAB-AP738-YC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.