Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-AP740-YC-F(E))

CAT#: HPAB-AP740-YC-F(E)

This product is a recombinant Mouse antibody Fab fragment that recognizes Mucin1. The antibody was purified by affinity chromatography.

Gene Expression
Figure 1 IF staining of human cell line RPTEC TERT1 Figure 2 IHC staining of human stomach Figure 3 IF staining of human cell line A-431 Figure 4 IF staining of human cell line U-2 OS Figure 5 Stomach Figure 6 Colon Figure 7 Kidney Figure 8 Testis Figure 9 RNA cell line category: Group enriched (CAPAN-2, OE19, RPTEC TERT1, T-47d)

Specifications

  • Immunogen
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
  • Host Species
  • Mouse
  • Type
  • Mouse Fab
  • Specificity
  • Human MUC1
  • Species Reactivity
  • Human
  • Applications
  • ELISA
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP740-YC-F(E). Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "MUC1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
AGTO-L036E anti-MUC1 immunotoxin C242 (Fab)-PE Cytotoxicity assay, Functional assay
AGTO-L064E anti-MUC1 immunotoxin H23 (scFv)-PE Cytotoxicity assay, Functional assay
CAT Product Name Application Type
TAB-0278CL-F(E) Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-0278CL-F(E)) ELISA, Internalization, BI, FuncS Human Fab
TAB-431MZ Anti-Human MUC1 Recombinant Antibody (PH1) ELISA, WB, FC, IHC, SPR Human antibody
TAB-432MZ Human Anti-MUC1 Recombinant Antibody (TAB-432MZ) ELISA, FC, FACS, DB, SPR Human IgG
TAB-433MZ Human Anti-MUC1 Recombinant Antibody (TAB-433MZ) ELISA, FC, FACS, DB, SPR Human IgG
TAB-434MZ Human Anti-MUC1 Recombinant Antibody (TAB-434MZ) ELISA, FC, FACS, DB, SPR Human IgG
CAT Product Name Application Type
Gly-012LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody
Gly-120LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) ELISA Mouse antibody
CAT Product Name Application Type
Gly-012LC-1 Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody
CAT Product Name Application Type
Gly-109LC Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) ELISA Human antibody
CAT Product Name Application Type
BRD-0379MZ Chicken Anti-MUC1 Polyclonal IgY IHC, WB Chicken antibody
CAT Product Name Application Type
MOR-2320 Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) IHC-P, IHC-Fr IgG
CAT Product Name Application Type
AFC-TAB-H56 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H56) FuncS, IF, Neut, ELISA, FC ADCC enhanced antibody
AFC-TAB-H65 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H65) ELISA, FC, IP, FuncS, IF ADCC enhanced antibody
AFC-TAB-026ML Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-026ML) ELISA, IHC, FC, IP, IF, FuncS ADCC enhanced antibody
AFC-TAB-166 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-166) IP, IF, FuncS, FC, Neut, ELISA ADCC enhanced antibody
AFC-TAB-H77 Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) ELISA, FC, IP, FuncS, IF IgG1, κ
CAT Product Name Application Type
HPAB-AP745-YC Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP745-YC) ELISA Mouse IgM
CAT Product Name Application Type
VS-0424-XY192 AbPlus™ Anti-MUC1 Magnetic Beads (139H2) IP, Protein Purification
VS-0724-YC1494 AbPlus™ Anti-MUC1 Magnetic Beads (VS-0724-YC1494) IP, Protein Purification
CAT Product Name Application Type
VS-0125-FY26 Human Anti-MUC1 (clone 1B2) scFv-Fc Chimera FC Human IgG1, scFv-Fc
CAT Product Name Application Type
VS-0225-XY169 CytoStream™ Mouse Anti-MUC1 Recombinant Antibody (VS-0225-XY169) FC Mouse IgG1, kappa
CAT Product Name Application Type
VS-0425-YC379 Recombinant Anti-MUC1 Vesicular Antibody, EV Displayed (VS-0425-YC379) ELISA, FC, Neut, Cell-uptake
CAT Product Name Application Type
VS-0525-YC131 Recombinant Anti-MUC1 Biparatopic Antibody, Tandem scFv ELISA, IHC Tandem scFv
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare