Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-AP740-YC-S(P))
CAT#: HPAB-AP740-YC-S(P)
This product is a recombinant mouse antibody scFv fragment that recognizes Mucin1. This monoclonal antibody MIN-C9-1 was generated to MUC1 peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA) using standard hybridoma generation. The antibody MIN-C9-1 scFv fragment was expressed and was purified by affinity chromatography. The fragment was screened for recognition of the MUC1 peptide by ELISA. The clone MIN-C9-1 scFv fragment was tested by FACS (fluorescence-activated cell sorting) for its ability to bind to MUC1 on intact cells.
Specifications
- Immunogen
- GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
- Host Species
- Mouse
- Type
- Mouse scFv
- Specificity
- Human MUC1
- Species Reactivity
- Human
- Applications
- ELISA
- Related Disease
- Cancer
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM
- Gene ID
- 4582
- UniProt ID
- P15941
Customer Review
There are currently no Customer reviews or questions for HPAB-AP740-YC-S(P). Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "MUC1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NAB-2049-VHH | Recombinant Anti-human MUC1 VHH Single Domain Antibody | WB, IP, ChiP, Neut, ELISA | Llama VHH |
| HPAB-AP504-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP504-YC) | FC | Camel VHH |
| HPAB-AP505-YC | Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP505-YC) | ELISA | Camel VHH |
| HPAB-0736-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0736-YJ-VHH) | ELISA | Camelid VHH |
| HPAB-0737-YJ-VHH | Camelid Anti-MUC1 Recombinant Single Domain Antibody (HPAB-0737-YJ-VHH) | ELISA | Camelid VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AGTO-L036E | anti-MUC1 immunotoxin C242 (Fab)-PE | Cytotoxicity assay, Functional assay | |
| AGTO-L064E | anti-MUC1 immunotoxin H23 (scFv)-PE | Cytotoxicity assay, Functional assay |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-411MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-411MZ) | ELISA | Mouse IgG |
| TAB-416MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-416MZ) | Block | Mouse IgG |
| TAB-417MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-417MZ) | IF | Mouse IgG |
| TAB-418MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-418MZ) | ELISA, FuncS, IHC, IF, FC, ADCC | Mouse IgG1 |
| TAB-419MZ | Mouse Anti-MUC1 Recombinant Antibody (TAB-419MZ) | ELISA, IHC, IF, FC | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-412MZ | Human Anti-MUC1 Recombinant Antibody (TAB-412MZ) | ELISA | Chimeric (mouse/human) IgG |
| TAB-412MZ-S(P) | Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-412MZ-S(P)) | ELISA | Mouse scFv |
| TAB-412MZ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-412MZ-F(E)) | ELISA | Chimeric (mouse/human) Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-413MZ | Human Anti-MUC1 Recombinant Antibody (TAB-413MZ) | ELISA | Humanized IgG |
| TAB-413MZ-F(E) | Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-413MZ-F(E)) | ELISA | Humanized Fab |
| TAB-425MZ-F(E) | Anti-Human MUC1 Recombinant Antibody Fab Fragment (huDMB5F3) | FC | Humanized antibody |
| TAB-430MZ-F(E) | Anti-Human MUC1 Recombinant Antibody Fab Fragment (BLC595) | ELISA, FC | Humanized antibody |
| TAB-026ML | Anti-Human MUC1 Recombinant Antibody (TAB-026ML) | ELISA, IHC, FC, IP, IF, FuncS | IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-431MZ-S(P) | Anti-Human MUC1 Recombinant Antibody scFv Fragment (PH1) | ELISA, WB, FC, IHC | Human antibody |
| TAB-432MZ-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-432MZ-S(P)) | ELISA, FC | Human scFv |
| TAB-433MZ-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-433MZ-S(P)) | ELISA, FC | Human scFv |
| TAB-434MZ-S(P) | Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-434MZ-S(P)) | ELISA, FC | Human scFv |
| PABX-143-F (E) | Recombinant Human Anti-MUC1 Antibody Fab Fragment (CTM01) | WB, ELISA, FuncS | Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-012LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
| Gly-120LC | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) | ELISA | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-012LC-1 | Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) | ELISA, FC, IHC | Humanized antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-109LC | Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) | ELISA | Human antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| Gly-121LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| Gly-122LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| Gly-124LC | Recombinant Anti-Human MUC1 Antibody (Non-glycosylated) | ELISA | Mouse antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0379MZ | Chicken Anti-MUC1 Polyclonal IgY | IHC, WB | Chicken antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2320 | Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) | IHC-P, IHC-Fr | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0838LC | Recombinant Mouse Anti-Human MUC1 Antibody (SM3) | ELISA | IgG1 |
| EPAF-0581CQ | Recombinant Mouse Anti-Human MUC1 Antibody (B27.29) | Neut, FC | IgG1 |
| EPAF-0583CQ | Recombinant Mouse Anti-Human MUC1 Antibody (BC4E549) | Neut, FC | IgG1 |
| EPAF-0584CQ | Recombinant Mouse Anti-Human MUC1 Antibody (DF3) | Neut, FC | IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0225-YC-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone MUSE11); Fab Fragment | IHC | Mouse Fab |
| HPAB-1159WJ-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone 12E); Fab Fragment | ELISA, ICC | Mouse Fab |
| HPAB-1160WJ-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone 3D); Fab Fragment | ELISA, ICC | Mouse Fab |
| HPAB-1161WJ-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone A5); Fab Fragment | ELISA, ICC | Mouse Fab |
| HPAB-1162WJ-F(E) | Mouse Anti-MUC1 Recombinant Antibody (clone C4); Fab Fragment | ELISA, ICC | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0670-CN | Human Anti-MUC1 Recombinant Antibody (HPAB-0670-CN) | FC | Human IgG4, κ |
| MRO-1039-CN | Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (CBACN-385) | WB, IF, IHC, IP, FC | Rabbit IgG |
| HPAB-AP738-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP738-YC) | ELISA | Mouse IgG |
| HPAB-AP739-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP739-YC) | ELISA | Mouse IgG |
| HPAB-AP740-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP740-YC) | ELISA | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| PSBC-399 | Mouse Anti-MUC1 Recombinant Antibody (clone AR20.5); scFv Fragment | ELISA, FC, FuncS | Mouse scFv |
| PSBC-400 | Mouse Anti-MUC1 Recombinant Antibody (clone SM3); scFv Fragment | FC, IHC-Fr, IF, ELISA, IHC-P | Mouse scFv |
| HPAB-J0212-YC-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone BW835); scFv Fragment | ELISA, IHC | Mouse scFv |
| HPAB-1159WJ-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone 12E); scFv Fragment | ELISA, ICC | Mouse scFv |
| HPAB-1160WJ-S(P) | Mouse Anti-MUC1 Recombinant Antibody (clone 3D); scFv Fragment | ELISA, ICC | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-H56 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H56) | FuncS, IF, Neut, ELISA, FC | ADCC enhanced antibody |
| AFC-TAB-H65 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H65) | ELISA, FC, IP, FuncS, IF | ADCC enhanced antibody |
| AFC-TAB-026ML | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-026ML) | ELISA, IHC, FC, IP, IF, FuncS | ADCC enhanced antibody |
| AFC-TAB-166 | Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-166) | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
| AFC-TAB-H77 | Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) | ELISA, FC, IP, FuncS, IF | IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-AP745-YC | Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP745-YC) | ELISA | Mouse IgM |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0424-XY192 | AbPlus™ Anti-MUC1 Magnetic Beads (139H2) | IP, Protein Purification | |
| VS-0724-YC1494 | AbPlus™ Anti-MUC1 Magnetic Beads (VS-0724-YC1494) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0125-FY26 | Human Anti-MUC1 (clone 1B2) scFv-Fc Chimera | FC | Human IgG1, scFv-Fc |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0225-XY169 | CytoStream™ Mouse Anti-MUC1 Recombinant Antibody (VS-0225-XY169) | FC | Mouse IgG1, kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY1394 | Anti-MUC1 Immunohistochemistry Kit | IHC | |
| VS-0525-XY4575 | Anti-Human MUC1 Immunohistochemistry Kit | IHC | |
| VS-0525-XY4576 | Anti-Mouse MUC1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC379 | Recombinant Anti-MUC1 Vesicular Antibody, EV Displayed (VS-0425-YC379) | ELISA, FC, Neut, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-YC131 | Recombinant Anti-MUC1 Biparatopic Antibody, Tandem scFv | ELISA, IHC | Tandem scFv |
Popular Products

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: WB, Neut, FuncS

Application: WB, ELISA, FuncS

Application: SPR, Inhib, FuncS

Application: WB, ELISA, Neut, FuncS

Application: ELISA, IHC, FC, IP, IF, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.















