Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP739-YC)

CAT#: HPAB-AP739-YC

This product is a recombinant Mouse antibody that recognizes Mucin1. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.

Gene Expression
Figure 1 IF staining of human cell line RPTEC TERT1 Figure 2 IHC staining of human stomach Figure 3 IF staining of human cell line A-431 Figure 4 IF staining of human cell line U-2 OS Figure 5 Stomach Figure 6 Colon Figure 7 Kidney Figure 8 Testis Figure 9 RNA cell line category: Group enriched (CAPAN-2, OE19, RPTEC TERT1, T-47d)

Specifications

  • Immunogen
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA
  • Host Species
  • Mouse
  • Type
  • Mouse IgG
  • Specificity
  • Human MUC1
  • Species Reactivity
  • Human
  • Applications
  • ELISA
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Mucin 1, Cell Surface Associated; Tumor-Associated Epithelial Membrane Antigen; Breast Carcinoma-Associated Antigen DF3; Peanut-Reactive Urinary Mucin; Polymorphic Epithelial Mucin; Carcinoma-Associated Mucin; Mucin 1, Transmembrane; Krebs Von Den Lungen-6; Cancer Antigen 15-3; Episialin; CA 15-3; H23AG; MUC-1; KL-6; PEMT; EMA; PUM; PEM
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-AP739-YC. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "MUC1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
NAB-2049-VHH Recombinant Anti-human MUC1 VHH Single Domain Antibody WB, IP, ChiP, Neut, ELISA Llama VHH
CAT Product Name Application Type
MOB-1077z Mouse Anti-MUC1 Recombinant Antibody (clone 18C4) WB, FC, IF, IHC Mouse IgG1, κ
CAT Product Name Application Type
TAB-173 Anti-Human MUC1 Recombinant Antibody (TAB-173) IF, IP, Neut, FuncS, ELISA, FC, ICC IgG1 - kappa
CAT Product Name Application Type
TAB-H56 Anti-Human MUC1 Recombinant Antibody (Pemtumomab) WB, FuncS, IF, Neut, ELISA, FC, IP IgG
CAT Product Name Application Type
TAB-H65 Anti-Human MUC1 Recombinant Antibody (Sontuzumab) WB, ELISA, FC, IP, FuncS, IF, Neut IgG1
CAT Product Name Application Type
TAB-166 Humanized Anti-MUC1 Recombinant Antibody (clone Cantuzumab) IP, IF, FuncS, FC, Neut, ELISA, ICC Humanized (from mouse) IgG1, κ
CAT Product Name Application Type
TAB-765 Mouse Anti-MUC1 Recombinant Antibody (clone Nacolomab); Fab Fragment FC, IP, ELISA, Neut, FuncS, IF, ICC Mouse Fab (IgG1, κ)
CAT Product Name Application Type
TAB-037-F(E) Anti-Human MUC1 Recombinant Antibody Fab Fragment (TAB-037-F(E)) Neut, ELISA, IF, IP, FuncS, FC, IHC Fab - G1 - kappa
CAT Product Name Application Type
TAB-H77 Human Anti-MUC1 Recombinant Antibody (TAB-H77) FuncS, Inhib IgG1, κ
CAT Product Name Application Type
AGTO-L036E anti-MUC1 immunotoxin C242 (Fab)-PE Cytotoxicity assay, Functional assay
CAT Product Name Application Type
AGTO-L064E anti-MUC1 immunotoxin H23 (scFv)-PE Cytotoxicity assay, Functional assay
CAT Product Name Application Type
PABL-662 Mouse Anti-MUC1 Recombinant Antibody WB, IF, FuncS Mouse IgG
CAT Product Name Application Type
PFBL-656 Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment WB, IF, FuncS Mouse Fab
CAT Product Name Application Type
PSBL-656 Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment WB, IF, FuncS Mouse scFv
CAT Product Name Application Type
TAB-0278CL Human Anti-MUC1 Recombinant Antibody (TAB-0278CL) ELISA, Internalization, BI, FuncS Human IgG
CAT Product Name Application Type
TAB-0388CL Mouse Anti-Human MUC1 Recombinant Antibody WB, IHC
CAT Product Name Application Type
TAB-0278CL-S(P) Human Anti-MUC1 Recombinant Antibody; scFv Fragment (TAB-0278CL-S(P)) ELISA, Internalization, BI, FuncS Human scFv
CAT Product Name Application Type
TAB-0278CL-F(E) Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-0278CL-F(E)) ELISA, Internalization, BI, FuncS Human Fab
CAT Product Name Application Type
TAB-412MZ Human Anti-MUC1 Recombinant Antibody (TAB-412MZ) ELISA Chimeric (mouse/human) IgG
CAT Product Name Application Type
TAB-431MZ Anti-Human MUC1 Recombinant Antibody (PH1) ELISA, WB, FC, IHC, SPR Human antibody
CAT Product Name Application Type
TAB-432MZ Human Anti-MUC1 Recombinant Antibody (TAB-432MZ) ELISA, FC, FACS, DB, SPR Human IgG
CAT Product Name Application Type
TAB-412MZ-F(E) Human Anti-MUC1 Recombinant Antibody; Fab Fragment (TAB-412MZ-F(E)) ELISA Chimeric (mouse/human) Fab
CAT Product Name Application Type
Gly-012LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody
Gly-012LC-1 Recombinant Anti-Human MUC1 Antibody (Fab glycosylation/Sialylated) ELISA, FC, IHC Humanized antibody
CAT Product Name Application Type
Gly-109LC Recombinant Anti-Human MUC1 Antibody (Fc glycosylation) ELISA Human antibody
CAT Product Name Application Type
Gly-120LC Recombinant Anti-Human MUC1 Antibody (Fab glycosylation) ELISA Mouse antibody
CAT Product Name Application Type
BRD-0379MZ Chicken Anti-MUC1 Polyclonal IgY IHC, WB Chicken antibody
CAT Product Name Application Type
MHC-LC054 PE-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer FCM
CAT Product Name Application Type
MHC-LC055 APC-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer FCM
CAT Product Name Application Type
MHC-LC056 BV421-A*02:01/Human MUC1 (LLLTVLTVV) MHC Tetramer FCM
CAT Product Name Application Type
MHC-LC096 PE-A*02:01/Human MUC1 (LLLLTVLTV) MHC Tetramer FCM
CAT Product Name Application Type
MHC-LC097 APC-A*02:01/Human MUC1 (LLLLTVLTV) MHC Tetramer FCM
CAT Product Name Application Type
MOR-2320 Hi-Affi™ Recombinant Rabbit Anti-MUC1 Monoclonal Antibody (DS2320AB) IHC-P, IHC-Fr IgG
CAT Product Name Application Type
EPAF-0838LC Recombinant Mouse Anti-Human MUC1 Antibody (SM3) ELISA IgG1
CAT Product Name Application Type
HPAB-0091-YC Mouse Anti-MUC1 Recombinant Antibody (HPAB-0091-YC) ELISA, Neut Mouse IgG
CAT Product Name Application Type
HPAB-0094-YC Mouse Anti-MUC1 Recombinant Antibody (clone 12D10) ELISA, FC Mouse IgG2a
CAT Product Name Application Type
HPAB-0091-YC-S(P) Mouse Anti-MUC1 Recombinant Antibody; scFv Fragment (HPAB-0091-YC-S(P)) ELISA, Neut Mouse scFv
CAT Product Name Application Type
HPAB-0094-YC-S(P) Mouse Anti-MUC1 Recombinant Antibody (clone 12D10); scFv Fragment ELISA, FC Mouse scFv
CAT Product Name Application Type
HPAB-0091-YC-F(E) Mouse Anti-MUC1 Recombinant Antibody; Fab Fragment (HPAB-0091-YC-F(E)) ELISA, Neut Mouse Fab
CAT Product Name Application Type
HPAB-0094-YC-F(E) Mouse Anti-MUC1 Recombinant Antibody (clone 12D10); Fab Fragment ELISA, FC Mouse Fab
CAT Product Name Application Type
EPAF-0581CQ Recombinant Mouse Anti-Human MUC1 Antibody (B27.29) Neut, FC IgG1
CAT Product Name Application Type
EPAF-0583CQ Recombinant Mouse Anti-Human MUC1 Antibody (BC4E549) Neut, FC IgG1
CAT Product Name Application Type
EPAF-0584CQ Recombinant Mouse Anti-Human MUC1 Antibody (DF3) Neut, FC IgG1
CAT Product Name Application Type
AFC-TAB-H56 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H56) FuncS, IF, Neut, ELISA, FC ADCC enhanced antibody
CAT Product Name Application Type
AFC-TAB-H65 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H65) ELISA, FC, IP, FuncS, IF ADCC enhanced antibody
CAT Product Name Application Type
AFC-TAB-026ML Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-026ML) ELISA, IHC, FC, IP, IF, FuncS ADCC enhanced antibody
CAT Product Name Application Type
AFC-TAB-166 Afuco™ Anti-MUC1 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-166) IP, IF, FuncS, FC, Neut, ELISA ADCC enhanced antibody
CAT Product Name Application Type
AFC-TAB-H77 Afuco™ Human Anti-MUC1 Recombinant Antibody, ADCC Enhanced (AFC-TAB-H77) ELISA, FC, IP, FuncS, IF IgG1, κ
CAT Product Name Application Type
HPAB-AP505-YC Recombinant Camel Anti-MUC1 Single Domain Antibody (HPAB-AP505-YC) ELISA Camel VHH
CAT Product Name Application Type
HPAB-AP745-YC Mouse Anti-MUC1 Recombinant Antibody (HPAB-AP745-YC) ELISA Mouse IgM
CAT Product Name Application Type
VS-0424-XY192 AbPlus™ Anti-MUC1 Magnetic Beads (139H2) IP, Protein Purification
CAT Product Name Application Type
VS-0724-YC1494 AbPlus™ Anti-MUC1 Magnetic Beads (VS-0724-YC1494) IP, Protein Purification
CAT Product Name Application Type
VS-0125-FY26 Human Anti-MUC1 (clone 1B2) scFv-Fc Chimera FC Human IgG1, scFv-Fc
CAT Product Name Application Type
VS-0225-XY169 CytoStream™ Mouse Anti-MUC1 Recombinant Antibody (VS-0225-XY169) FC Mouse IgG1, kappa
CAT Product Name Application Type
VS-0325-XY1394 Anti-MUC1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0425-YC379 Recombinant Anti-MUC1 Vesicular Antibody, EV Displayed (VS-0425-YC379) ELISA, FC, Neut, Cell-uptake
CAT Product Name Application Type
VS-0525-XY4575 Anti-Human MUC1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-XY4576 Anti-Mouse MUC1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-YC131 Recombinant Anti-MUC1 Biparatopic Antibody, Tandem scFv ELISA, IHC Tandem scFv
CAT Product Name Application Type
VS-0825-YC261 SmartAb™ Recombinant Anti-MUC1 pH-dependent Antibody (VS-0825-YC261) ELISA, IHC, Inhib Human IgG kappa
CAT Product Name Application Type
VS-1025-YC167 Anti-MUC1 Antibody Prodrug, Protease Activated (VS-1025-YC167) ISZ, Cyt, FuncS
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare