Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv
CAT#: VS-0525-YC133
The Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv is a biparatopic antibody (bpAb) that binds two distinct MUC16 epitopes. This bpAb features tandem scFv arms engineered for simultaneous, high-affinity binding to the amino acid sequences: NFSPLARRVDRVAIYEE and KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL.
Gene Expression
Normal Tissue
Figure 1 Cervix
Glandular cells
Staining:
High
Intensity: Strong
Quantity:>75%
Location: Cytoplasmic/
membranous
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/65600/166228_B_7_3.jpg
RNA Expression
Figure 2 RNA cell line category: Group enriched (A-431, HeLa)
Cell lines ordered by descending RNA expression order.
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000181143-MUC16
❮
❯
Specifications
- Host Animal 1
- Mouse
- Host Animal 2
- Mouse
- Specificity
- Human MUC16
- Species Reactivity
- Human
- Type
- Tandem scFv
- Valency
- 1 + 1
- Epitope 1
- In a sequence: NFSPLARRVDRVAIYEE
- Epitope 2
- In a sequence: KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL
- Purity
- >90%
- Purification
- Affinity purified
- Applications
- ELISA, FC, IHC, WB
- Concentration
- Lot specific
- Buffer
- PBS, pH 7.4
- Preservative
- No preservatives
- Storage
- Store at 4°C for short term. Aliquot and store at -20°C for long term. Avoid freeze-thaw cycles.
- Long Name
- Mucin 16, Cell Surface Associated
Target
- Introduction
- This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.
- Alternative Names
- Mucin 16, Cell Surface Associated; Ovarian Cancer-Related Tumor Marker CA125; Ovarian Carcinoma Antigen CA125; CA125; CA125 Ovarian Cancer Antigen; Mucin-16; CA-125; MUC-16;
- Gene ID
- 94025
- UniProt ID
- Q8WXI7
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for VS-0525-YC133. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
Protocol & Troubleshooting
We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.
See other products for "MUC16"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-H63 | Humanized Anti-MUC16 Recombinant V-kappa Antibody (TAB-H63) | IF, IP, Neut, FuncS, ELISA, FC, WB | Humanized IgG1, κ |
| TAB-0339CL | Human Anti-MUC16 Recombinant Antibody (TAB-0339CL) | DB, WB, IP, ELISA, FC, CDC | Humanized Antibody |
| TAB-1397CL | Human Anti-MUC16 Recombinant Antibody (TAB-1397CL) | FuncS | Humanized IgG |
| TAB-1397CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1397CL-F(E)) | FuncS | Humanized Fab |
| TAB-1399CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1399CL-F(E)) | FuncS | Humanized Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-114 | Anti-Human CA-125 Recombinant Antibody (TAB-114) | IP, IF, FuncS, FC, Neut, ELISA, ICC | IgG1 - kappa |
| TAB-1401CL | Anti-Human MUC16 Recombinant Antibody (OC125) | IF, IHC, IP, FC | |
| TAB-1402CL | Anti-Human MUC16 Recombinant Antibody (VK-8) | IF, FC | |
| TAB-1401CL-F(E) | Anti-Human MUC16 Recombinant Antibody Fab Fragment (OC125) | IF, IHC, IP, FC | |
| TAB-1402CL-F(E) | Anti-Human MUC16 Recombinant Antibody Fab Fragment (VK-8) | IF, FC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1398CL | Human Anti-MUC16 Recombinant Antibody (TAB-1398CL) | FuncS | Chimeric (mouse/human) IgG |
| TAB-1400CL | Human Anti-MUC16 Recombinant Antibody (TAB-1400CL) | FuncS | Chimeric (mouse/human) IgG |
| TAB-1398CL-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (TAB-1398CL-S(P)) | FuncS | Mouse scFv |
| TAB-1398CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1398CL-F(E)) | FuncS | Chimeric (mouse/human) Fab |
| TAB-1400CL-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (TAB-1400CL-F(E)) | FuncS | Chimeric (mouse/human) Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2321 | Hi-Affi™ Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (DS2321AB) | ICC, IHC-P, WB | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0310-YC-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0310-YC-F(E)) | ELISA, FC, IHC, FuncS | Mouse Fab |
| HPAB-0120LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0120LY-F(E)) | WB, ELISA, FC, IHC | Mouse Fab |
| HPAB-0121LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0121LY-F(E)) | WB, ELISA, FC, IHC | Mouse Fab |
| HPAB-0122LY-F(E) | Mouse Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-0122LY-F(E)) | WB, ELISA, FC, IHC | Mouse Fab |
| HPAB-N0185-YC-F(E) | Human Anti-MUC16 Recombinant Antibody; Fab Fragment (HPAB-N0185-YC-F(E)) | FuncS | Humanized Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0043-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody (clone 196-14); scFv Fragment | FuncS | Mouse scFv |
| FAMAB-0044-YC-S(P) | Mouse Anti-MUC16 Recombinant Antibody (clone ch196-14); scFv Fragment | FuncS | Mouse scFv |
| HPAB-1114LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1114LY-S(P)) | ELISA | Mouse scfv |
| HPAB-1115LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1115LY-S(P)) | ELISA | Mouse scfv |
| HPAB-1116LY-S(P) | Mouse Anti-MUC16 Recombinant Antibody; scFv Fragment (HPAB-1116LY-S(P)) | ELISA | Mouse scfv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MRO-1040-CN | Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (CBACN-386) | WB, IF, FC | Rabbit IgG |
| MRO-1041-CN | Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (CBACN-387) | WB, IF, FC | Rabbit IgG |
| VS3-XY1123 | Mouse Anti-MUC16 Recombinant Antibody (clone CA009) | IHC, WB | Mouse IgG |
| VS3-WK1075 | Mouse Anti-MUC16 Recombinant Antibody (VS3-WK1075) | IHC | Mouse IgG1 |
| VS3-WK1076 | Mouse Anti-MUC16 Recombinant Antibody (clone CA-125) | IHC | Mouse IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| AFC-TAB-114 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-114) | IP, IF, FuncS, FC, Neut, ELISA | ADCC enhanced antibody |
| AFC-TAB-H63 | Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H63) | IF, IP, Neut, FuncS, ELISA, FC | ADCC enhanced antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0924-YC140 | Human Anti-MUC16 Recombinant Antibody Hexamer (VS-0924-YC140), CDC Enhanced | DB, WB, IP, ELISA, FC, CDC | Antibody hexamer |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-FY70 | Mouse Anti-MUC16 (clone VK-8) scFv-Fc Chimera | IF, FC | Mouse IgG1, scFv-Fc |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC337 | Recombinant Anti-MUC16 Vesicular Antibody, EV Displayed (VS-0425-YC337) | ELISA, FC, Neut, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4578 | Anti-MUC16 Immunohistochemistry Kit | IHC |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: ELISA, Neut, IF, IP, FC, FuncS
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: IP, IF, FuncS, FC, Neut, ELISA, IHC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: FC, IB, Block, Inhib, FuncS, ELISA, FACS, IP, IF
-2.png)
Application: WB, ELISA, FC, IHC, IP
Application: Neut, ELISA, FuncS
Application: Neut, FC, IHC-Fr, IP, BA
Application: FC, IHC-Fr, IP, ELISA, Block
Application: ELISA, Neut
Application: ELISA, Neut
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
