Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv

CAT#: VS-0525-YC133

The Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv is a biparatopic antibody (bpAb) that binds two distinct MUC16 epitopes. This bpAb features tandem scFv arms engineered for simultaneous, high-affinity binding to the amino acid sequences: NFSPLARRVDRVAIYEE and KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL.

Gene Expression
Figure 1 Cervix Figure 2 RNA cell line category: Group enriched (A-431, HeLa)

Specifications

  • Host Animal 1
  • Mouse
  • Host Animal 2
  • Mouse
  • Specificity
  • Human MUC16
  • Species Reactivity
  • Human
  • Type
  • Tandem scFv
  • Valency
  • 1 + 1
  • Epitope 1
  • In a sequence: NFSPLARRVDRVAIYEE
  • Epitope 2
  • In a sequence: KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL
  • Purity
  • >90%
  • Purification
  • Affinity purified
  • Applications
  • ELISA, FC, IHC, WB
  • Concentration
  • Lot specific
  • Buffer
  • PBS, pH 7.4
  • Preservative
  • No preservatives
  • Storage
  • Store at 4°C for short term. Aliquot and store at -20°C for long term. Avoid freeze-thaw cycles.
  • Long Name
  • Mucin 16, Cell Surface Associated

Target

  • Introduction
  • This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.
  • Alternative Names
  • Mucin 16, Cell Surface Associated; Ovarian Cancer-Related Tumor Marker CA125; Ovarian Carcinoma Antigen CA125; CA125; CA125 Ovarian Cancer Antigen; Mucin-16; CA-125; MUC-16;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for VS-0525-YC133. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

Protocol & Troubleshooting

We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.

See other products for "MUC16"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOR-2321 Hi-Affi™ Recombinant Rabbit Anti-MUC16 Monoclonal Antibody (DS2321AB) ICC, IHC-P, WB IgG
CAT Product Name Application Type
AFC-TAB-114 Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-114) IP, IF, FuncS, FC, Neut, ELISA ADCC enhanced antibody
AFC-TAB-H63 Afuco™ Anti-MUC16 ADCC Recombinant Antibody, ADCC Enhanced (AFC-TAB-H63) IF, IP, Neut, FuncS, ELISA, FC ADCC enhanced antibody
CAT Product Name Application Type
VS-0924-YC140 Human Anti-MUC16 Recombinant Antibody Hexamer (VS-0924-YC140), CDC Enhanced DB, WB, IP, ELISA, FC, CDC Antibody hexamer
CAT Product Name Application Type
VS-0425-FY70 Mouse Anti-MUC16 (clone VK-8) scFv-Fc Chimera IF, FC Mouse IgG1, scFv-Fc
CAT Product Name Application Type
VS-0425-YC337 Recombinant Anti-MUC16 Vesicular Antibody, EV Displayed (VS-0425-YC337) ELISA, FC, Neut, Cell-uptake
CAT Product Name Application Type
VS-0525-XY4578 Anti-MUC16 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Merry Christmas & Happy New Year
Happy Thanksgiving close ad