Recombinant Anti-MUC16 Biparatopic Antibody, Tandem scFv (CAT#: VS-0525-YC133)

• Host Animal 1
• Mouse

• Host Animal 2
• Mouse

• Specificity
• Human MUC16

• Species Reactivity
• Human

• Type
• Tandem scFv

• Valency
• 1 + 1

• Epitope 1
• In a sequence: NFSPLARRVDRVAIYEE

• Epitope 2
• In a sequence: KSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPL

• Purity
• >90%

• Purification
• Affinity purified

• Applications
• ELISA, FC, IHC, WB

• Concentration
• Lot specific

• Buffer
• PBS, pH 7.4

• Preservative
• No preservatives

• Storage
• Store at 4°C for short term. Aliquot and store at -20°C for long term. Avoid freeze-thaw cycles.

• Long Name
• Mucin 16, Cell Surface Associated

• Introduction
• This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.

• Alternative Names
• Mucin 16, Cell Surface Associated; Ovarian Cancer-Related Tumor Marker CA125; Ovarian Carcinoma Antigen CA125; CA125; CA125 Ovarian Cancer Antigen; Mucin-16; CA-125; MUC-16;

• Gene ID
• 94025

• UniProt ID
• Q8WXI7

Select a product category from the dropdown menu below to view related products.