Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0322YC-VHH) (CAT#: FAMAB-0322YC-VHH)
Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH50, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD).
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Glandular cells
Staining: High
Intensity: Strong
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/48540/165696_A_2_8.jpg

(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000152266-PTH/subcellular
Specifications
- Host Species
- Llama
- Derivation
- Naïve llama sdAb library
- Type
- Llama VHH
- Specificity
- Human PTH
- Species Reactivity
- Human
- Clone
- FAMAB-0322YC-VHH
- Applications
- ELISA
- Related Disease
- Osteoporosis
Product Property
- Purity
- >95% as determined by analysis by SDS-PAGE
- Storage
- Store at -20°C for long-term storage. Avoid freeze/thaw cycles.
Target
Related Resources
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "PTH"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-3105z | Mouse Anti-PTH Recombinant Antibody (clone 36H12) | ICC, IF, IHC | Mouse IgG2b |
MOB-0194MZ | Recombinant Mouse Anti-PTH (a.a. 1-34) Antibody (clone C1240M) | ELISA, RIA | Mouse antibody |
MOB-0169F | Mouse Anti-PTH Recombinant Antibody (MOB-0169F) | IHC-P, IF | Mouse IgG |
MOB-0170F | Mouse Anti-PTH Recombinant Antibody (MOB-0170F) | IHC-P, IF | Mouse IgG |
ZG-0200U | Mouse Anti-PTH Recombinant Antibody (clone 4D1H11) | ELISA | Mouse IgG1 |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for FAMAB-0322YC-VHH. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: WB, IP, IF, FuncS, FC, Neut, ELISA
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, IHC
Application: FuncS, Inhib, IP, ELISA
Application: Neut, Inhib, FC, ELISA
Application: WB, ELISA, FC, IHC, IP
Application: ELISA
Application: WB, ELISA, FuncS, IB, FC, SPR, Apop
Application: ELISA, Inhib, FuncS
Application: ELISA, FC, Neut, Inhib
Application: ELISA, Block, WB, FC, IP
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.