Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0322YC-VHH)
CAT#: FAMAB-0322YC-VHH
Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH50, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD).
Gene Expression
Normal Tissue
Figure 1 Parathyroid gland
Glandular cells
Staining: High
Intensity: Strong
Quantity:>75%
Location: Cytoplasmic/membranous
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/48540/165696_A_2_8.jpg
RNA Expression
Figure 2 RNA cell line categoryi : Not detected
Cell lines ordered by descending RNA expression order.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000152266-PTH/subcellular
❮
❯
Specifications
- Host Species
- Llama
- Derivation
- Naïve llama sdAb library
- Type
- Llama VHH
- Specificity
- Human PTH
- Species Reactivity
- Human
- Clone
- FAMAB-0322YC-VHH
- Applications
- ELISA
- Related Disease
- Osteoporosis
Product Property
- Purity
- >95% as determined by analysis by SDS-PAGE
- Storage
- Store at -20°C for long-term storage. Avoid freeze/thaw cycles.
Target
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for FAMAB-0322YC-VHH. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Related Diseases
Rheumatoid Arthritis
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
See other products for "PTH"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-718CL | Human Anti-PTH Recombinant Antibody (TAB-718CL) | ELISA | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2923 | Hi-Affi™ Recombinant Rabbit Anti-PTH Monoclonal Antibody (DS2923AB) | IHC | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0319-CN-S(P) | Human Anti-PTH Recombinant Antibody; scFv Fragment (HPAB-0319-CN-S(P)) | ELISA, IF, Neut | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0319-CN-F(E) | Human Anti-PTH Recombinant Antibody; Fab Fragment (HPAB-0319-CN-F(E)) | ELISA, IF, Neut | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0323YC-VHH | Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0323YC-VHH) | ELISA | Llama VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-0169F | Mouse Anti-PTH Recombinant Antibody (MOB-0169F) | IHC-P, IF | Mouse IgG |
| MOB-0170F | Mouse Anti-PTH Recombinant Antibody (MOB-0170F) | IHC-P, IF | Mouse IgG |
| VS3-QX931 | Mouse Anti-PTH Recombinant Antibody (clone 2C7) | WB, IHC, ICC, FC, ELISA | Mouse IgG2b |
| VS3-FY1218 | Recombinant Mouse Anti-PTH Antibody (clone 8C5H9) | ELISA, FC, IHC, ICC | Mouse IgG2b |
| VS3-FY1219 | Recombinant Mouse Anti-PTH Antibody (clone 10A7-9G5-10A10) | IHC-P | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY5838 | Anti-PTH Immunohistochemistry Kit | IHC | |
| VS-0525-XY5839 | Anti-Mouse PTH Immunohistochemistry Kit | IHC |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: WB, IHC, FC, Cyt, ELISA
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, WB, FC, IHC, IP
Application: ELISA, PD, Activ, PK, Stim
Application: WB, FC, IF, Inhib, ELISA, IHC
Application: FC
Application: ELISA, FuncS, RIA, IP, IF, IHC, IA, Block
Application: EM, ELISA, ICC, IHC-Fr, IHC-P, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
