Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0322YC-VHH)

CAT#: FAMAB-0322YC-VHH

Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH50, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD).

Gene Expression
Figure 1 Parathyroid gland Figure 2 RNA cell line categoryi : Not detected

Specifications

  • Host Species
  • Llama
  • Derivation
  • Naïve llama sdAb library
  • Type
  • Llama VHH
  • Specificity
  • Human PTH
  • Species Reactivity
  • Human
  • Clone
  • FAMAB-0322YC-VHH
  • Applications
  • ELISA
  • Related Disease
  • Osteoporosis

Product Property

  • Purity
  • >95% as determined by analysis by SDS-PAGE
  • Storage
  • Store at -20°C for long-term storage. Avoid freeze/thaw cycles.

Target

  • Alternative Names
  • PTH1
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for FAMAB-0322YC-VHH. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Related Diseases

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "PTH"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
TAB-718CL Human Anti-PTH Recombinant Antibody (TAB-718CL) ELISA Human IgG
CAT Product Name Application Type
HPAB-0319-CN-S(P) Human Anti-PTH Recombinant Antibody; scFv Fragment (HPAB-0319-CN-S(P)) ELISA, IF, Neut Human scFv
CAT Product Name Application Type
HPAB-0319-CN-F(E) Human Anti-PTH Recombinant Antibody; Fab Fragment (HPAB-0319-CN-F(E)) ELISA, IF, Neut Human Fab
CAT Product Name Application Type
VS-0625-YC271 Recombinant Anti-PTH Eliminating Antibody, pH-Sensitive (VS-0625-YC271) Antigen-Sweeping In Vivo. Human IgG2 kappa
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Merry Christmas & Happy New Year
Happy Thanksgiving close ad