Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0323YC-VHH) (CAT#: FAMAB-0323YC-VHH)

Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH22, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD). PTH22 bind to the PTH peptide antigen as PTH50 but only effectively when biotinylated
peptide is in complex with streptavidin.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue
RNA Expression

Specifications

  • Host Species
  • Llama
  • Derivation
  • Naïve llama sdAb library
  • Type
  • Llama VHH
  • Specificity
  • Human PTH
  • Species Reactivity
  • Human
  • Clone
  • FAMAB-0323YC-VHH
  • Applications
  • ELISA
  • Related Disease
  • Osteoporosis

Product Property

  • Purity
  • >95% as determined by analysis by SDS-PAGE
  • Storage
  • Store at -20°C for long-term storage. Avoid freeze/thaw cycles.

Target

  • Alternative Names
  • PTH1

Related Resources

  • Related Diseases

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "PTH"

Select a product category from the dropdown menu below to view related products.
Please select product type
Human Antibody Products Rabbit Monoclonal Antibody Products ScFv Antibody Products Fab Antibody Products Single Domain Antibody Products IgG Antibody Products
CAT Product Name Application Type
TAB-718CL Human Anti-PTH Recombinant Antibody (TAB-718CL) ELISA Human IgG

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for FAMAB-0323YC-VHH. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare