Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0323YC-VHH)
CAT#: FAMAB-0323YC-VHH
Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH22, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD). PTH22 bind to the PTH peptide antigen as PTH50 but only effectively when biotinylated
peptide is in complex with streptavidin.
Specifications
- Host Species
- Llama
- Derivation
- Naïve llama sdAb library
- Type
- Llama VHH
- Specificity
- Human PTH
- Species Reactivity
- Human
- Clone
- FAMAB-0323YC-VHH
- Applications
- ELISA
- Related Disease
- Osteoporosis
Product Property
- Purity
- >95% as determined by analysis by SDS-PAGE
- Storage
- Store at -20°C for long-term storage. Avoid freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for FAMAB-0323YC-VHH. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Related Diseases
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "PTH"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-718CL | Human Anti-PTH Recombinant Antibody (TAB-718CL) | ELISA | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2923 | Hi-Affi™ Recombinant Rabbit Anti-PTH Monoclonal Antibody (DS2923AB) | IHC | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0319-CN | Human Anti-PTH Recombinant Antibody (HPAB-0319-CN) | ELISA, IF, Neut | Human IgG2, κ |
| ZG-037R | Mouse Anti-PTH Recombinant Antibody (ZG-037R) | WB, ELISA | Mouse IgG |
| ZG-038R | Mouse Anti-PTH Recombinant Antibody (ZG-038R) | WB, ELISA, IHC, IF | Mouse IgG |
| VS1-YJ169 | Mouse Anti-PTH Recombinant Antibody (clone BAM1916) | WB | Mouse IgG2b |
| VS1-YJ170 | Mouse Anti-PTH Recombinant Antibody (clone BAM87) | ELISA, IHC-P | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0319-CN-S(P) | Human Anti-PTH Recombinant Antibody; scFv Fragment (HPAB-0319-CN-S(P)) | ELISA, IF, Neut | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0319-CN-F(E) | Human Anti-PTH Recombinant Antibody; Fab Fragment (HPAB-0319-CN-F(E)) | ELISA, IF, Neut | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| FAMAB-0322YC-VHH | Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0322YC-VHH) | ELISA | Llama VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY5838 | Anti-PTH Immunohistochemistry Kit | IHC | |
| VS-0525-XY5839 | Anti-Mouse PTH Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0625-YC271 | Recombinant Anti-PTH Eliminating Antibody, pH-Sensitive (VS-0625-YC271) | Antigen-Sweeping In Vivo. | Human IgG2 kappa |
Popular Products

Application: Neut, ELISA, IF, IP, FuncS, FC, IHC

Application: WB, ELISA, IP, FC, FuncS, Neut, IF

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: WB, ELISA, FuncS

Application: WB, Neut, FuncS

Application: ELISA, FC, Neut, Inhib

Application: ELISA, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.


Rheumatoid Arthritis













