Mouse Anti-TTYH1 Antibody (clone Ttyh1-11), mRNA
CAT#: HPAB-M0323-YC-mRNA
This mRNA encodes a Mouse antibody against TTYH1. It contains two mRNAs that encode for the heavy and light chains of the antibody.
Specifications
- Immunogen
- Recombinant mouse Ttyhl molecule comprises native mouse Ttyhl molecules of 111 to 124 amino acids (111-GNSETSDGVSQLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGA RRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRW-124).
- Host Species
- Mouse
- Specificity
- Mouse TTYH1
- Species Reactivity
- Mouse
- Clone
- Ttyh1-11
Product Property
- Purity
- >95%
- Storage
- Store at -20°C.
Target
Customer Review
There are currently no Customer reviews or questions for HPAB-M0323-YC-mRNA. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "Clone Ttyh1-11"
- CAT
- Product Name
See other products for "TTYH1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-2117CT | Recombinant Mouse anti-Human TTYH1 Monoclonal antibody (EML1758) | WB | |
| HPAB-M0323-YC | Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11) | WB, IF, IHC | Mouse IgG1, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0323-YC-S(P) | Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11); scFv Fragment | WB, IF, IHC | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-M0323-YC-F(E) | Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11); Fab Fragment | WB, IF, IHC | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC477 | Recombinant Anti-TTYH1 Vesicular Antibody, EV Displayed (VS-0425-YC477) | ELISA, FC, Cell-uptake |
Popular Products

Application: FC, IP, ELISA, Neut, FuncS, IF, WB

Application: WB, FC, IP, ELISA, Neut, FuncS, IF
-2.jpg)
Application: IB, ELISA, FC, FuncS
-2.png)
Application: IB, ELISA, FC, FuncS

Application: FC, ADCC, CDC, Inhib

Application: ELISA, IHC, FC, IP, IF, Inhib

Application: ELISA, IHC, FC, IP, IF, Inhib
-2.png)
Application: ELISA

Application: WB, IHC-Fr, IHC-P, ICC, IF
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.














