Mouse Anti-TTYH1 Antibody (clone Ttyh1-11), mRNA

CAT#: HPAB-M0323-YC-mRNA

This mRNA encodes a Mouse antibody against TTYH1. It contains two mRNAs that encode for the heavy and light chains of the antibody.

Gene Expression
Figure 1 IF staining of human cell line U-2 OS Figure 2 Cerebral cortex Figure 3 Cerebellum Figure 4 Kidney Figure 5 Testis Figure 6 RNA cell line category: Cell line enhanced (AF22, AN3-CA, U-2 OS)

Specifications

  • Immunogen
  • Recombinant mouse Ttyhl molecule comprises native mouse Ttyhl molecules of 111 to 124 amino acids (111-GNSETSDGVSQLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGA RRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRW-124).
  • Host Species
  • Mouse
  • Specificity
  • Mouse TTYH1
  • Species Reactivity
  • Mouse
  • Clone
  • Ttyh1-11

Product Property

  • Purity
  • >95%
  • Storage
  • Store at -20°C.

Target

  • Alternative Names
  • Tweety Family Member 1; HTTY1; Tweety (Drosophila) Homolog 1; Tweety Homolog 1 (Drosophila); Protein Tweety Homolog 1; Tweety Homolog 1;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-M0323-YC-mRNA. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "Clone Ttyh1-11"

See other products for "TTYH1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
HPAB-M0323-YC-S(P) Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11); scFv Fragment WB, IF, IHC Mouse scFv
CAT Product Name Application Type
HPAB-M0323-YC-F(E) Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11); Fab Fragment WB, IF, IHC Mouse Fab
CAT Product Name Application Type
VS-0425-YC477 Recombinant Anti-TTYH1 Vesicular Antibody, EV Displayed (VS-0425-YC477) ELISA, FC, Cell-uptake
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare