Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11) (CAT#: HPAB-M0323-YC)

The anti-Ttyh1 monoclonal antibody can carry out immunoblotting, cellular immunofluorescence staining and immunohistofluorescence staining, can specifically mark mouse neural stem cells, can provide a useful tool for labeling, separation, purification and identification of mouse neural stem cells and can provide a technical support for neural stem cell-related basis and transformation medical research.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • Recombinant mouse Ttyhl molecule comprises native mouse Ttyhl molecules of 111 to 124 amino acids (111-GNSETSDGVSQLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGA RRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRW-124).
  • Host Species
  • Mouse
  • Type
  • Mouse IgG1, κ
  • Specificity
  • Mouse TTYH1
  • Species Reactivity
  • Mouse
  • Clone
  • Ttyh1-11
  • Applications
  • WB, IF, IHC

Product Property

  • Purity
  • >95% as determined by SDS-PAGE and HPLC analysis
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • Tweety Family Member 1; HTTY1; Tweety (Drosophila) Homolog 1; Tweety Homolog 1 (Drosophila); Protein Tweety Homolog 1; Tweety Homolog 1;

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Clone Ttyh1-11"

See other products for "TTYH1"

Select a product category from the dropdown menu below to view related products.
Please select product type
IgG Antibody Products ScFv Antibody Products Fab Antibody Products Extracellular Vesicle (EV) Antibody Products

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-M0323-YC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare