Mouse Anti-TTYH1 Recombinant Antibody (clone Ttyh1-11) (CAT#: HPAB-M0323-YC)
The anti-Ttyh1 monoclonal antibody can carry out immunoblotting, cellular immunofluorescence staining and immunohistofluorescence staining, can specifically mark mouse neural stem cells, can provide a useful tool for labeling, separation, purification and identification of mouse neural stem cells and can provide a technical support for neural stem cell-related basis and transformation medical research.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/5725/1947_G9_1_selected.jpg

(Neuropil Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/23617/71436_B_7_5.jpg

(G L U G L U Processes in molecular layer Staining: High Intensity: Strong Purkinje cells - cytoplasm/membrane Staining: Medium Intensity: Moderate Synaptic glomeruli - capsule Staining: Low Intensity: Weak)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/23617/71436_B_8_8.jpg

(Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/23617/71436_A_9_5.jpg

(Elongated or late spermatids Staining: Low Intensity: Moderate Quantity: <25% Leydig cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Pachytene spermatocytes Staining: Low Intensity: Moderate Quantity: <25%)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/23617/71436_A_6_6.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000167614-TTYH1
Specifications
- Immunogen
- Recombinant mouse Ttyhl molecule comprises native mouse Ttyhl molecules of 111 to 124 amino acids (111-GNSETSDGVSQLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGA RRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRW-124).
- Host Species
- Mouse
- Type
- Mouse IgG1, κ
- Specificity
- Mouse TTYH1
- Species Reactivity
- Mouse
- Clone
- Ttyh1-11
- Applications
- WB, IF, IHC
Product Property
- Purity
- >95% as determined by SDS-PAGE and HPLC analysis
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Tweety Family Member 1; HTTY1; Tweety (Drosophila) Homolog 1; Tweety Homolog 1 (Drosophila); Protein Tweety Homolog 1; Tweety Homolog 1;
- Gene ID
- 57776
- UniProt ID
- Q9D3A9
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone Ttyh1-11"
See other products for "TTYH1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-2117CT | Recombinant Mouse anti-Human TTYH1 Monoclonal antibody (EML1758) | WB |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-M0323-YC. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, IF, IP, Neut, FuncS, ELISA, FC
Application: ELISA, Neut, IF, IP, FC, FuncS
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, IHC
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, WB
Application: ELISA, IHC, FC, IP, IF, BL
Application: FC
Application: ELISA, FC, WB, Inhib, IHC
Application: ELISA, Inhib, FuncS
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.