Recombinant Human Anti-C5AR1 Antibody (CAT#: EPAF-1006LC)

This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Host Species
  • Human
  • Type
  • IgG
  • Specificity
  • Human C5a anaphylatoxin chemotactic receptor
  • Species Reactivity
  • Human
  • Applications
  • Blocking

Target

  • Alternative Names
  • C5AR1; complement C5a receptor 1; C5A; C5AR; C5R1; CD88

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "C5AR1"

Neutralizing Antibody

Blocking Antibody

CAT Product Name Application Type
NEUT-097CQ Rat Anti-C5AR1 Recombinant Antibody (clone 20/70) FC, Block Rat IgG2b, κ

Rabbit Monoclonal Antibody

Epitope-Specific Antibody

CAT Product Name Application Type
EPAF-0571CQ Human Anti-C5AR1 Recombinant Antibody (clone Fab400) ELISA Human IgG

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare