Anti-Dog (Canine) Leptin Antibody (CAT#: MOB-0214MC)
Polyclonal rabbit Antibody specifically binds to Dog (Canine) Leptin.
Specific Inquiry
Specifications
- Immunogen
- MHWTLCFLWLWPLFAPIKDDTKTLIKTITRINDISHTS
- Host Species
- Rabbit
- Species Reactivity
- Bovine, Dog, oat, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Property
- Purification
- Affinity Purified
- Format
- Lyophilized powder. Add 0 ul of distilled water. Final anti-LEP antibody concentration is 1 mg/ml in PBS buffer with 2 sucrose.
- Concentration
- 1.0 mg/ml
- Buffer
- For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles
- Storage
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Leptin"
Chicken IgY Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-1141MZ | Chicken Anti-Rat Leptin Polyclonal IgY | WB, ELISA | Chicken antibody |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MOB-0214MC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.