Mouse Anti-OMP Antibody (2B7) (CAT#: MOB-022CS)
This product is a mouse antibody which is specific for OMP. It can be used for various applications such as ELISA, WB.
Specific Inquiry
RNA Expression
Figure 1 RNA cell line category: Cell line enhanced (CACO-2, OE19)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000254550-OMP
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000254550-OMP
Figure 1 RNA cell line category: Cell line enhanced (CACO-2, OE19)
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000254550-OMP
(Cell lines ordered by descending RNA expression order.)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000254550-OMP
Specifications
- Immunogen
- Partial recombinant OMP (Sequence:FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL)
- Host Species
- Mouse
- Type
- Mouse IgG2a, κ
- Species Reactivity
- Human
- Clone
- 2B7
- Applications
- Used for immunoassay techniques such as: Enzyme-linked immunosorbent assay; Western Blot
Product Property
- Purity
- >95% as determined by analysis by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration
- Storage
- Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "OMP"
Recombinant Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1272z | Mouse Anti-OMP Recombinant Antibody (clone 19B10) | WB, IP, IF, IHC, ELISA | Mouse IgG2a, κ |
| VS3-FY1808 | Rabbit Anti-Omp Recombinant Antibody (clone R07-4I2) | WB, IP | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for MOB-022CS. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.