Chicken Anti-CCL4 Polyclonal IgY (CAT#: BRD-0886MZ)

This antibody is a chicken polyclonal antibody which specifically reacts with CCL4.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue

Specifications

  • Immunogen
  • synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta
  • Host Species
  • Chicken
  • Type
  • Chicken antibody
  • Species Reactivity
  • Human
  • Applications
  • ELISA, WB

Target

  • Alternative Names
  • ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "CCL4"

Single-domain Antibody

CAT Product Name Application Type
NAB-386-sdAb Recombinant Anti-Human CCL4 VHH Single Domain Antibody IHC, IP, FC, Neut, FUNC Llama VHH

Recombinant Antibody

Chicken IgY Antibody

CAT Product Name Application Type
BRD-0361MZ Chicken Anti-MIP-1β Polyclonal IgY Indirect ELISA, WB Chicken antibody

Neutralizing Antibody

Rabbit Monoclonal Antibody

CAT Product Name Application Type
MOR-0509 Hi-Affi™ Rabbit Anti-CCL4 Recombinant Antibody (clone DS509AB) WB Rabbit IgG

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for BRD-0886MZ. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare