Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH22, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD). PTH22 bind to the PTH peptide antigen as PTH50 but only effectively when biotinylated
peptide is in complex with streptavidin.
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Download resources about recombinant antibody development and antibody engineering to boost your research.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-718CL | Human Anti-PTH Recombinant Antibody (TAB-718CL) | ELISA | Human IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
MOR-2923 | Hi-Affi™ Recombinant Rabbit Anti-PTH Monoclonal Antibody (DS2923AB) | IHC | IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0319-CN-S(P) | Human Anti-PTH Recombinant Antibody; scFv Fragment (HPAB-0319-CN-S(P)) | ELISA, IF, Neut | Human scFv |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0319-CN-F(E) | Human Anti-PTH Recombinant Antibody; Fab Fragment (HPAB-0319-CN-F(E)) | ELISA, IF, Neut | Human Fab |
CAT | Product Name | Application | Type |
---|---|---|---|
FAMAB-0322YC-VHH | Recombinant Llama Anti-PTH Single Domain Antibody (FAMAB-0322YC-VHH) | ELISA | Llama VHH |
CAT | Product Name | Application | Type |
---|---|---|---|
MOB-0169F | Mouse Anti-PTH Recombinant Antibody (MOB-0169F) | IHC-P, IF | Mouse IgG |
MOB-0170F | Mouse Anti-PTH Recombinant Antibody (MOB-0170F) | IHC-P, IF | Mouse IgG |
ZG-037R | Mouse Anti-PTH Recombinant Antibody (ZG-037R) | WB, ELISA | Mouse IgG |
ZG-038R | Mouse Anti-PTH Recombinant Antibody (ZG-038R) | WB, ELISA, IHC, IF | Mouse IgG |
ZG-0200U | Mouse Anti-PTH Recombinant Antibody (clone 4D1H11) | ELISA | Mouse IgG1 |
There are currently no Customer reviews or questions for FAMAB-0323YC-VHH. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.