Mouse Anti-CDKN2A Recombinant Antibody (clone P1) (CAT#: HPAB-M0037-YC)
Provided is a cancer-related gene CDKN2A epitope polypeptide monoclonal antibody. According to the gene CDKN2A monoclonal antibody, the high-conservative protein sequence of a gene CDKN2A serves as target protein, epitope polypeptide is designed and synthesized and coupled with the carrier protein to serve as immunogen, and the gene CDKN2A monoclonal antibody is obtained through the immunogen. The monoclonal antibody and the designed and synthesized epitope polypeptide can be used for detecting quantitative expression of human blood or the tissue CDKN2A antibody, has the advantages of high specificity and high sensitivity, and will be widely applied to clinical detection and experimental studies.
Specific Inquiry
Subcellular Location
Normal Tissue
RNA Expression
Figure 1 IF staining of human cell line PC-3
(Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg
(Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/47838/979_F9_4_selected.jpg
Figure 2 IHC staining of human stomach
(Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg
(Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/93/ihc_selected.jpg
Figure 3 Tonsil
(High expression in tonsil)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg
(High expression in tonsil)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_4_8_val_selected.jpg
Figure 4 IHC staining of human tonsil
(Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg
(Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/18232/ihc_selected.jpg
Figure 5 Lymph node
(Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg
(Germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: nuclear Non-germinal center cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_8.jpg
Figure 6 Kidney
(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg
(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Nuclear Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous nuclear)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/445/2553_A_8_5.jpg
Figure 7 RNA cell line category: Cell line enhanced (CAPAN-2, HEK93, HeLa, SK-MEL-30)
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000147889-CDKN2A
Specifications
- Immunogen
- CDKN2A epitope polypeptide: ATERIYHFVVGQMVYYQCVQGYRALHRGPAESV, conjugated to KLH
- Host Species
- Mouse
- Type
- Mouse IgG
- Specificity
- Human CDKN2A
- Species Reactivity
- Human
- Clone
- P1
- Applications
- ELISA
Product Property
- Purity
- >95% as determined by SDS-PAGE and HPLC analysis
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
- Alternative Names
- Cyclin Dependent Kinase Inhibitor 2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Cyclin-Dependent Kinase 4 Inhibitor A; Cyclin-Dependent Kinase Inhibitor 2A; Multiple Tumor Suppressor 1; Alternative Reading Frame; P16-INK4A; P16INK4A; P14ARF; CDKN2; CDK4I; MTS-1; MTS1; MLM;
- Gene ID
- 1029
- UniProt ID
- P42771
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "Clone P1"
See other products for "CDKN2A"
Chicken IgY Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0116MZ | Chicken Anti-CDKN2A Polyclonal IgY | WB | Chicken antibody |
Rabbit Monoclonal Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0642 | Hi-Affi™ Rabbit Anti-CDKN2A Recombinant Antibody (clone DS642AB) | FC, ICC, IF, WB | Rabbit IgG |
scFv Fragment Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); scfv Fragment | IHC, WB | Mouse scfv |
| HPAB-M0037-YC-S(P) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); scFv Fragment | ELISA | Mouse scFv |
Fab Fragment Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0877LY-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone CBL015); Fab Fragment | IHC, WB | Mouse Fab |
| HPAB-M0037-YC-F(E) | Mouse Anti-CDKN2A Recombinant Antibody (clone P1); Fab Fragment | ELISA | Mouse Fab |
Recombinant Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| ZG-0333C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0333C) | WB, IHC, ELISA | Mouse IgG |
| ZG-0334C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0334C) | WB, IHC, ELISA | Mouse IgG |
| ZG-0335C | Mouse Anti-CDKN2A Recombinant Antibody (ZG-0335C) | WB, IHC, ELISA | Mouse IgG |
| VS3-FY359 | Recombinant Mouse Anti-CDKN2A Antibody (clone 5B6A8) | ELISA, WB, IHC, FC | Mouse IgG1 |
| VS3-FY360 | Recombinant Rabbit Anti-CDKN2A Antibody (clone R02-6H1) | WB, IP | Rabbit IgG |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for HPAB-M0037-YC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.