MAb 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the monoclonal antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Download resources about recombinant antibody development and antibody engineering to boost your research.
CAT | Product Name | Application | Type |
---|---|---|---|
MOR-2233 | Hi-Affi™ Recombinant Rabbit Anti-MIEN1 Monoclonal Antibody (DS2233AB) | WB | IgG |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAb165) | ELISA, WB, IF | Human IgG1, κ |
HPAB-0011CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAb171) | ELISA, WB, IF | Human IgG1, κ |
HPAB-0012CQ | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009) | ELISA, WB, IF | Human IgG1, κ |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAb165); scFv Fragment | ELISA, WB, IF | Human scFv |
HPAB-0011CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAb171); scFv Fragment | ELISA, WB, IF | Human scFv |
HPAB-0012CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009); scFv Fragment | ELISA, WB, IF | Human scFv |
HPAB-0013CQ-S(P) | Human Anti-MIEN1 Recombinant Antibody (clone MAb163); scFv Fragment | ELISA, WB, IF | Human scFv |
CAT | Product Name | Application | Type |
---|---|---|---|
HPAB-0010CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb165); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0011CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb171); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0012CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAbc009); Fab Fragment | ELISA, WB, IF | Human Fab |
HPAB-0013CQ-F(E) | Human Anti-MIEN1 Recombinant Antibody (clone MAb163); Fab Fragment | ELISA, WB, IF | Human Fab |
There are currently no Customer reviews or questions for HPAB-0013CQ. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.