Human Anti-MIEN1 Recombinant Antibody (clone MAb163) (CAT#: HPAB-0013CQ)

MAb 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the monoclonal antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location and Protein Expression
Normal Tissue
RNA Expression

Specifications

  • Host Species
  • Human
  • Derivation
  • Human
  • Type
  • Human IgG1, κ
  • Specificity
  • Human MIEN1
  • Species Reactivity
  • Human
  • Clone
  • MAb163
  • Applications
  • ELISA, WB, IF
  • Related Disease
  • Cancers

Product Property

  • Purity
  • >95% as determined by SDS-PAGE and HPLC analysis
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • C35; ORB3; XTP4; RDX12; C17orf37

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "Clone MAb163"

See other products for "MIEN1"

Rabbit Monoclonal Antibody

Recombinant Antibody

CAT Product Name Application Type
HPAB-0010CQ Human Anti-MIEN1 Recombinant Antibody (clone MAb165) ELISA, WB, IF Human IgG1, κ
HPAB-0011CQ Human Anti-MIEN1 Recombinant Antibody (clone MAb171) ELISA, WB, IF Human IgG1, κ
HPAB-0012CQ Human Anti-MIEN1 Recombinant Antibody (clone MAbc009) ELISA, WB, IF Human IgG1, κ

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for HPAB-0013CQ. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare