Human Anti-CXCR3 Recombinant Antibody (HPAB-AP315-YC) (CAT#: HPAB-AP315-YC)

This product is a recombinant human antibody that recognizes CXCR3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • An N-terminal peptide fragment of the CXCR3 extracellular domain (EC domain), with the amino acid sequence, MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSC, was conjugated to KLH by the C terminal cysteine.
  • Host Species
  • Human
  • Derivation
  • Chimeric (mouse/human)
  • Type
  • Chimeric (mouse/human) IgG
  • Specificity
  • Human CXCR3
  • Species Reactivity
  • Human
  • Applications
  • FC, Inhib

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • C-X-C Motif Chemokine Receptor 3; G Protein-Coupled Receptor 9; Interferon-Inducible Protein 10 Receptor; Chemokine (C-X-C Motif) Receptor 3; IP-10 Receptor; CKR-L2; GPR9; C-X-C Chemokine Receptor Type 3; Chemokine Receptor 3; CD183 Antigen

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "CXCR3"

Immunotoxin

CAT Product Name Application Type
AGTO-L073D IP10-DT immunotoxin Cytotoxicity assay, Functional assay

Humanized Antibody

CAT Product Name Application Type
TAB-136MZ-S(P) Anti-Human CXCR3 Recombinant Antibody scFv Fragment (Ab1) FC, Binding and chemotaxis assay Humanized antibody
TAB-137MZ-S(P) Anti-Human CXCR3 Recombinant Antibody scFv Fragment (Ab2) FC, Binding and chemotaxis assay Humanized antibody
TAB-138MZ-S(P) Anti-Human CXCR3 Recombinant Antibody scFv Fragment (Ab3) FC, Binding and chemotaxis assay Humanized antibody
TAB-139MZ-S(P) Anti-Human CXCR3 Recombinant Antibody scFv Fragment (Ab4) FC, Binding and chemotaxis assay Humanized antibody
TAB-140MZ-S(P) Anti-Human CXCR3 Recombinant Antibody scFv Fragment (Ab5) FC, Binding and chemotaxis assay Humanized antibody

Blocking Antibody

CAT Product Name Application Type
NEUT-678CQ Mouse Anti-CXCR3 Recombinant Antibody (clone G025H7) FC, Block Mouse IgG1, κ
NEUT-683CQ Hamster Anti-Cxcr3 Recombinant Antibody (clone CXCR3-173) FC, Block Hamster IgG

Neutralizing Antibody

CAT Product Name Application Type
NEUT-679CQ Mouse Anti-CXCR3 Recombinant Antibody (clone 2Ar1) ICC, IF, IHC-P, IHC-Fr, Neut, FC Mouse IgG1
NEUT-680CQ Mouse Anti-CXCR3 Recombinant Antibody (clone CBL045) FC, IHC, Neut Mouse IgG1
NEUT-681CQ Mouse Anti-CXCR3 Recombinant Antibody (clone CBL794) FC, IHC, CyTOF®, Neut Mouse IgG1
NEUT-682CQ Mouse Anti-CXCR3 Recombinant Antibody (clone MM0223-7K22) IHC-Fr, Neut, FC Mouse IgG1

Rabbit Monoclonal Antibody

CAT Product Name Application Type
MOR-0888 Hi-Affi™ Rabbit Anti-CXCR3 Recombinant Antibody (clone DS888AB) WB, ICC, IF, IP Rabbit IgG

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for HPAB-AP315-YC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare