Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-10)
CAT#: EPAF-1587LC
This product is a mouse monoclonal antibody that specifically recognizes SATTVFDVTTLNPTIAGAGDVKASAEGQLG, which is an linear epitope on Major outer membrane porin from Chlamydia trachomatis Serovar L2. The MOMP-binding antibody L21-10 is an epitope-specific antibody that can be used in western blotting.
Specifications
- Host Species
- Mouse
- Specificity
- Chlamydia trachomatis Serovar L2 Major outer membrane porin
- Species Reactivity
- C. trachomatis Serovar L2
- Clone
- L21-10
- Applications
- Western Blot
Target
Customer Review
There are currently no Customer reviews or questions for EPAF-1587LC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "C. trachomatis L2 MOMP"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-1583LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-45) | ELISA | |
| EPAF-1585LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-5) | WB | IgG3 |
Popular Products

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
-2-1.png)
Application: IP, IF, FuncS, FC, Neut, ELISA, IHC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
-3.png)
Application: ELISA, FC, Block, SPR

Application: WB, ELISA, FC, IHC, IP

Application: ELISA, IHC, FC, IP, IF, FuncS

Application: ELISA, FC, Inhib, IHC-Fr, WB, IP

Application: ELISA, FC, FuncS

Application: ELISA, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.














