Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-10) (CAT#: EPAF-1587LC)
This product is a mouse monoclonal antibody that specifically recognizes SATTVFDVTTLNPTIAGAGDVKASAEGQLG, which is an linear epitope on Major outer membrane porin from Chlamydia trachomatis Serovar L2. The MOMP-binding antibody L21-10 is an epitope-specific antibody that can be used in western blotting.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
Specifications
- Host Species
- Mouse
- Specificity
- Chlamydia trachomatis Serovar L2 Major outer membrane porin
- Species Reactivity
- C. trachomatis Serovar L2
- Clone
- L21-10
- Applications
- Western Blot
Target
- Alternative Names
- C. trachomatis L2 MOMP; Chlamydia trachomatis Serovar L2; C. trachomatis L2; MOMP; Major outer membrane porin
- Gene ID
- 5858320
- UniProt ID
- P06597
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "C. trachomatis L2 MOMP"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
EPAF-1583LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-45) | ELISA | |
EPAF-1585LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-5) | WB | IgG3 |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for EPAF-1587LC. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, IHC
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, Neut, FuncS
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, IHC, IF, IP, FC, FuncS
Application: ELISA, FuncS
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.