Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-10) (CAT#: EPAF-1587LC)
This product is a mouse monoclonal antibody that specifically recognizes SATTVFDVTTLNPTIAGAGDVKASAEGQLG, which is an linear epitope on Major outer membrane porin from Chlamydia trachomatis Serovar L2. The MOMP-binding antibody L21-10 is an epitope-specific antibody that can be used in western blotting.
Specific Inquiry
Specifications
- Host Species
- Mouse
- Specificity
- Chlamydia trachomatis Serovar L2 Major outer membrane porin
- Species Reactivity
- C. trachomatis Serovar L2
- Clone
- L21-10
- Applications
- Western Blot
Target
- Alternative Names
- C. trachomatis L2 MOMP; Chlamydia trachomatis Serovar L2; C. trachomatis L2; MOMP; Major outer membrane porin
- Gene ID
- 5858320
- UniProt ID
- P06597
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "C. trachomatis L2 MOMP"
Epitope-Specific Antibody
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-1583LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-45) | ELISA | |
| EPAF-1585LC | Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-5) | WB | IgG3 |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for EPAF-1587LC. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.