Recombinant Mouse anti-Chicken KCNA2 Monoclonal antibody (ML)
CAT#: MOB-2475CT
Recombinant Mouse Monoclonall antibody to Chicken KCNA2, expressed in Chinese Hamster Ovary cells(CHO).
Specifications
- Immunogen
- Recombinant fusion protein (QYLQVTSCPKIPSSPDLKKSRASTISKSDYMEIQEGVNN SNEDFREENLKANCTLANTNYVNITKMLTDV) representing amino acid residues 428-499 of rat KCNA2.
- Host Species
- Mouse
- Antibody Isotype
- IgG2b
- Species Reactivity
- Chicken
- Clone
- ML
- Applications
- Used for immunoassay techniques such as: Immunocytochemistry; Western Blot; Immunohistochemistry paraffin embedded sections; Immunohistochemistry (Frozen sections)
- Conjugate
- Unconjugated
Product Property
- Purity
- Protein G purified
- Format
- Liquid
- Buffer
- Preservative: 0.09% Sodium Azide. Constituents: 50% Glycerol, PBS, pH 7.4
- Storage
- Store at -20°C. Stable for 12 months at -20°C
Target
- Alternative Names
- KCNA2; potassium voltage-gated channel, shaker-related subfamily, member 2; potassium voltage-gated channel subfamily A member 2; voltage-gated potassium channel Kv1.2; shaker subfamily potassium channel Kv1.2 alpha subunit;
- Gene ID
- 395117
- Protein Refseq
- NP_989794
- Function
- ion channel activity; voltage-gated ion channel activity; voltage-gated potassium channel activity;
Customer Review
There are currently no Customer reviews or questions for MOB-2475CT. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "KCNA2"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY1177 | Anti-KCNA2 Immunohistochemistry Kit | IHC |
Popular Products

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, IHC

Application: FC, IHC, FuncS, Inhib, Cyt

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, WB, BLI, SPR

Application: WB, IHC, FC, Cyt, ELISA
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.











