Recombinant Mouse anti-Chicken KCNA2 Monoclonal antibody (ML)

CAT#: MOB-2475CT

Recombinant Mouse Monoclonall antibody to Chicken KCNA2, expressed in Chinese Hamster Ovary cells(CHO).

Gene Expression
Figure 1 High expression in cerebral cortex. Figure 2 Low expression in pancreas. Figure 3 Cerebral cortex Figure 4 Caudate Figure 5 RNA cell line category: Cell line enhanced (Karpas-707, SCLC-21H, U-2 OS, U-266/70, U-266/84, WM-115)

Specifications

  • Immunogen
  • Recombinant fusion protein (QYLQVTSCPKIPSSPDLKKSRASTISKSDYMEIQEGVNN SNEDFREENLKANCTLANTNYVNITKMLTDV) representing amino acid residues 428-499 of rat KCNA2.
  • Host Species
  • Mouse
  • Antibody Isotype
  • IgG2b
  • Species Reactivity
  • Chicken
  • Clone
  • ML
  • Applications
  • Used for immunoassay techniques such as: Immunocytochemistry; Western Blot; Immunohistochemistry paraffin embedded sections; Immunohistochemistry (Frozen sections)
  • Conjugate
  • Unconjugated

Product Property

  • Purity
  • Protein G purified
  • Format
  • Liquid
  • Buffer
  • Preservative: 0.09% Sodium Azide. Constituents: 50% Glycerol, PBS, pH 7.4
  • Storage
  • Store at -20°C. Stable for 12 months at -20°C

Target

  • Alternative Names
  • KCNA2; potassium voltage-gated channel, shaker-related subfamily, member 2; potassium voltage-gated channel subfamily A member 2; voltage-gated potassium channel Kv1.2; shaker subfamily potassium channel Kv1.2 alpha subunit;
  • Function
  • ion channel activity; voltage-gated ion channel activity; voltage-gated potassium channel activity;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MOB-2475CT. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "KCNA2"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
VS-0325-XY1177 Anti-KCNA2 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare