Recombinant Mouse anti-Human PHLDA3 Monoclonal antibody (nBcdbn)
CAT#: MOB-2455CT
Recombinant Mouse Monoclonall antibody to Human PHLDA3, expressed in Chinese Hamster Ovary cells(CHO).
Specifications
- Immunogen
- Synthetic peptide (MTAAATATVLKEGVLEKRSGGLLQLWKRKRC) representing amino acid residues 1-31 of human PHLDA3.
- Host Species
- Mouse
- Antibody Isotype
- IgG2b
- Specificity
- Widely expressed with lowest expression in liver and spleen.
- Species Reactivity
- Human
- Clone
- nBcdbn
- Applications
- Used for immunoassay techniques such as: Western Blot
- Conjugate
- Unconjugated
Product Property
- Purity
- IgG fraction
- Format
- Liquid
- Buffer
- Preservative: None. Constituents: 50% Glycerol, PBS
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Target
- Alternative Names
- PHLDA3; pleckstrin homology-like domain, family A, member 3; TIH1; pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1; pleckstrin homology-like domain, family A, member 2;
- Gene ID
- 23612
- UniProt ID
- Q9Y5J5
- Protein Refseq
- NP_036528
- Function
- phosphatidylinositol-3,4,5-trisphosphate binding; phosphatidylinositol-3,4-bisphosphate binding; phosphatidylinositol-3,5-bisphosphate binding; phosphatidylinositol-3-phosphate binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-5
Customer Review
There are currently no Customer reviews or questions for MOB-2455CT. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Popular Products

Application: WB, FC, IP, ELISA, Neut, FuncS, IF

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: ELISA, Neut, IF, IP, FC, FuncS

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
-2.png)
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: Inhib, Cyt

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: ELISA, WB, BLI, SPR

Application: Block, Cyt, FuncS, Inhib

Application: WB, Neut, FuncS

Application: Neut, ELISA, Inhib, ICC, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.








