Recombinant Mouse anti-Human PHLDA3 Monoclonal antibody (nBcdbn)
CAT#: MOB-2455CT
Recombinant Mouse Monoclonall antibody to Human PHLDA3, expressed in Chinese Hamster Ovary cells(CHO).
Gene Expression
Normal Tissue
Figure 1 IHC staining of human urinary bladder
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_5_5_selected.jpg
Normal Tissue
Figure 2 Cerebral cortex
Endothelial cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous Neuronal cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous Neuropil Staining: Low Intensity: Weak Quantity:>75% Location: Cytoplasmic/ membranous
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_B_9_5.jpg
Normal Tissue
Figure 3 Colon
Endothelial cells Staining: Low Intensity: Weak Quantity:>75% Location: Cytoplasmic/ membranous Glandular cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_8_3.jpg
Normal Tissue
Figure 4 Liver
Hepatocytes Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_7_4.jpg
Normal Tissue
Figure 5 Kidney
Cells in tubules Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_9_5.jpg
Normal Tissue
Figure 6 Testis
Elongated or late spermatids Staining: Medium Intensity: Moderate Quantity:>75% Leydig cells Staining: Medium Intensity: Moderate Quantity:>75% Sertoli cells Staining: Low Intensity: Weak Quantity:>75%
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_6_6.jpg
Normal Tissue
Figure 7 Lymph node
Non-germinal center cells Staining: Low Intensity: Moderate Quantity: <25% Location: Cytoplasmic/ membranous nuclear
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/images/27601/60556_A_8_8.jpg
RNA Expression
Figure 8 RNA cell line category: Cell line enhanced (BEWO, WM-115)
Cell lines ordered by descending RNA expression order.
* Image credit: Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000174307-PHLDA3
❮
❯
Specifications
- Immunogen
- Synthetic peptide (MTAAATATVLKEGVLEKRSGGLLQLWKRKRC) representing amino acid residues 1-31 of human PHLDA3.
- Host Species
- Mouse
- Specificity
- Widely expressed with lowest expression in liver and spleen.
- Species Reactivity
- Human
- Clone
- nBcdbn
- Applications
- Used for immunoassay techniques such as: Western Blot
- Conjugate
- Unconjugated
Product Property
- Purity
- IgG fraction
- Format
- Liquid
- Buffer
- Preservative: None. Constituents: 50% Glycerol, PBS
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Target
- Alternative Names
- PHLDA3; pleckstrin homology-like domain, family A, member 3; TIH1; pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1; pleckstrin homology-like domain, family A, member 2;
- Gene ID
- 23612
- UniProt ID
- Q9Y5J5
- Protein Refseq
- NP_036528
- Function
- phosphatidylinositol-3,4,5-trisphosphate binding; phosphatidylinositol-3,4-bisphosphate binding; phosphatidylinositol-3,5-bisphosphate binding; phosphatidylinositol-3-phosphate binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-5
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for MOB-2455CT. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: Neut, ELISA, IF, IP, FuncS, FC, WB
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: ELISA, SPR, Inhib, FuncS
Application: ELISA, Inhib, FC
Application: ELISA, IHC, FC, WB, IF, IA
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: FC
Application: ELISA, Neut
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
