Recombinant Mouse anti-Human PHLDA3 Monoclonal antibody (nBcdbn)

CAT#: MOB-2455CT

Recombinant Mouse Monoclonall antibody to Human PHLDA3, expressed in Chinese Hamster Ovary cells(CHO).

Gene Expression
Figure 1 IHC staining of human urinary bladder Figure 2 Cerebral cortex Figure 3 Colon Figure 4 Liver Figure 5 Kidney Figure 6 Testis Figure 7 Lymph node Figure 8 RNA cell line category: Cell line enhanced (BEWO, WM-115)

Specifications

  • Immunogen
  • Synthetic peptide (MTAAATATVLKEGVLEKRSGGLLQLWKRKRC) representing amino acid residues 1-31 of human PHLDA3.
  • Host Species
  • Mouse
  • Antibody Isotype
  • IgG2b
  • Specificity
  • Widely expressed with lowest expression in liver and spleen.
  • Species Reactivity
  • Human
  • Clone
  • nBcdbn
  • Applications
  • Used for immunoassay techniques such as: Western Blot
  • Conjugate
  • Unconjugated

Product Property

  • Purity
  • IgG fraction
  • Format
  • Liquid
  • Buffer
  • Preservative: None. Constituents: 50% Glycerol, PBS
  • Storage
  • Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Target

  • Alternative Names
  • PHLDA3; pleckstrin homology-like domain, family A, member 3; TIH1; pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1; pleckstrin homology-like domain, family A, member 2;
  • Function
  • phosphatidylinositol-3,4,5-trisphosphate binding; phosphatidylinositol-3,4-bisphosphate binding; phosphatidylinositol-3,5-bisphosphate binding; phosphatidylinositol-3-phosphate binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-5
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MOB-2455CT. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare