Recombinant Mouse anti-Human TOR2A Monoclonal antibody (G40)

CAT#: MOB-2416CT

Recombinant Mouse Monoclonall antibody to Human TOR2A, expressed in Chinese Hamster Ovary cells(CHO).

Gene Expression
Figure 1 IF staining of human cell line REH Figure 2 IHC staining of human smooth muscle Figure 3 Cerebral cortex Figure 4 RNA cell line category: Low cell line specificity

Specifications

  • Immunogen
  • Synthetic peptide (GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS) corresponding to amino acid residues 51-100 of human Salusin alpha.
  • Host Species
  • Mouse
  • Species Reactivity
  • Human
  • Clone
  • G40
  • Applications
  • Used for immunoassay techniques such as: Western Blot
  • Conjugate
  • Unconjugated

Product Property

  • Purity
  • Immunogen affinity purified
  • Format
  • Liquid
  • Buffer
  • Preservative: None. Constituents: 2% Sucrose, PBS
  • Storage
  • Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

Target

  • Alternative Names
  • TOR2A; torsin family 2, member A; TORP1; prosalusin; torsin-2A; salusin-beta; torsin-related protein 1;
  • Function
  • ATP binding; hormone activity; nucleoside-triphosphatase activity; nucleotide binding;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MOB-2416CT. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Happy Thanksgiving
Happy Thanksgiving close ad