Recombinant Mouse anti-Cow NDUFV2 Monoclonal antibody (F307)
CAT#: MOB-2433CT
Recombinant Mouse Monoclonall antibody to Cow NDUFV2, expressed in Chinese Hamster Ovary cells(CHO).
Specifications
- Immunogen
- Recombinant protein fragment representing amino acid residues 150-249 (EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAK) of human NDUFV2, fused with a proprietary affinity tag.
- Host Species
- Mouse
- Antibody Isotype
- IgG2a
- Species Reactivity
- Cow
- Clone
- F307
- Applications
- Used for immunoassay techniques such as: Western Blot; Enzyme-linked Immunosorbent Assay
- Conjugate
- Unconjugated
Product Property
- Purity
- Protein A purified
- Format
- Liquid
- Buffer
- Preservative: None. Constituents: 1X PBS, pH 7.2
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Target
- Alternative Names
- NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH dehydrogenase flavoprotein 2; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone reductase 24 kDa mitochondrial; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial-like;
- Gene ID
- 282290
- Protein Refseq
- NP_776990
- Function
- 2 iron, 2 sulfur cluster binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; metal ion binding; oxidoreductase activity;
Customer Review
There are currently no Customer reviews or questions for MOB-2433CT. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "NDUFV2"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2406 | Hi-Affi™ Recombinant Rabbit Anti-NDUFV2 Monoclonal Antibody (DS2406AB) | WB, IHC-P, ICC, IF, IP | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC308 | AbPlus™ Anti-NDUFV2 Magnetic Beads (VS-0724-YC308) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4758 | Anti-NDUFV2 Immunohistochemistry Kit | IHC |
Popular Products

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: WB, FC, IP, ELISA, Neut, FuncS, IF

Application: FC, IP, ELISA, Neut, FuncS, IF, IHC

Application: FC, IP, ELISA, Neut, FuncS, IF, ICC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: IF, IP, Neut, FuncS, ELISA, FC, WB

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: WB, ELISA, FC, IP, FuncS, IF, Neut

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: FuncS, Inhib, IP, ELISA
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.







