Recombinant Mouse anti-Cow NDUFV2 Monoclonal antibody (F307)

CAT#: MOB-2433CT

Recombinant Mouse Monoclonall antibody to Cow NDUFV2, expressed in Chinese Hamster Ovary cells(CHO).

Gene Expression
Figure 1 IF staining of human cell line U-2 OS Figure 2 IHC staining of human rectum Figure 3 Cerebral cortex Figure 4 Colon Figure 5 Liver Figure 6 Kidney Figure 7 Testis Figure 8 Lymph node Figure 9 RNA cell line category: Low cell line specificity

Specifications

  • Immunogen
  • Recombinant protein fragment representing amino acid residues 150-249 (EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAK) of human NDUFV2, fused with a proprietary affinity tag.
  • Host Species
  • Mouse
  • Antibody Isotype
  • IgG2a
  • Species Reactivity
  • Cow
  • Clone
  • F307
  • Applications
  • Used for immunoassay techniques such as: Western Blot; Enzyme-linked Immunosorbent Assay
  • Conjugate
  • Unconjugated

Product Property

  • Purity
  • Protein A purified
  • Format
  • Liquid
  • Buffer
  • Preservative: None. Constituents: 1X PBS, pH 7.2
  • Storage
  • Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

Target

  • Alternative Names
  • NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH dehydrogenase flavoprotein 2; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone reductase 24 kDa mitochondrial; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial-like;
  • Function
  • 2 iron, 2 sulfur cluster binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; metal ion binding; oxidoreductase activity;
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for MOB-2433CT. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "NDUFV2"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOR-2406 Hi-Affi™ Recombinant Rabbit Anti-NDUFV2 Monoclonal Antibody (DS2406AB) WB, IHC-P, ICC, IF, IP IgG
CAT Product Name Application Type
VS-0724-YC308 AbPlus™ Anti-NDUFV2 Magnetic Beads (VS-0724-YC308) IP, Protein Purification
CAT Product Name Application Type
VS-0525-XY4758 Anti-NDUFV2 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare