Recombinant Mouse anti-Human NARF Monoclonal antibody (M03)
CAT#: MOB-0015CT
Recombinant Mouse monoclonal antibody to Human NARF, expressed in Chinese Hamster Ovary cells(CHO).
Specifications
- Immunogen
- The immunogen is a recombinant fragment of human nuclear autoantigen with RING finger (NARF), spanning amino acids 1 to 101, with the sequence MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCP.
- Host Species
- Mouse
- Species Reactivity
- Human
- Clone
- M03
- Applications
- Used for immunoassay techniques such as: Western Blot
- Conjugate
- Unconjugated
Product Property
- Purity
- Ascites
- Format
- Liquid
- Buffer
- Preservative: None Constituents: Ascites
- Storage
- Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Target
- Alternative Names
- NARF; nuclear prelamin A recognition factor; IOP2; iron-only hydrogenase-like protein 2; prenyl-dependent prelamin A binding protein;
- Gene ID
- 26502
- UniProt ID
- Q9UHQ1
- Protein Refseq
- NP_001033707
- Function
- lamin binding;
Customer Review
There are currently no Customer reviews or questions for MOB-0015CT. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Popular Products

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: IF, IP, Neut, FuncS, ELISA, FC, WB

Application: FuncS, IF, Neut, ELISA, FC, IP, WB

Application: FC, IP, ELISA, Neut, FuncS, IF, IHC

Application: ELISA, IHC, FC, IP, IF, FuncS

Application: ELISA, IHC, FC, IP, IF, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.










-2.png)





