Chicken Anti-CCL4 Polyclonal IgY

CAT#: BRD-0886MZ

This antibody is a chicken polyclonal antibody which specifically reacts with CCL4.

Gene Expression
Figure 1 Cerebral cortex Figure 2 Testis

Specifications

  • Immunogen
  • Synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, reflecting amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta
  • Host Species
  • Chicken
  • Type
  • Chicken antibody
  • Antibody Isotype
  • IgY
  • Species Reactivity
  • Human
  • Applications
  • ELISA, WB

Target

  • Alternative Names
  • ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for BRD-0886MZ. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "CCL4"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
NAB-386-sdAb Recombinant Anti-Human CCL4 VHH Single Domain Antibody IHC, IP, FC, Neut, FUNC Llama VHH
CAT Product Name Application Type
MOB-1453z Mouse Anti-CCL4 Recombinant Antibody (clone 27F11) WB, ELISA Mouse IgG1
CAT Product Name Application Type
BRD-0361MZ Chicken Anti-MIP-1β Polyclonal IgY Indirect ELISA, WB Chicken antibody
CAT Product Name Application Type
NEUT-225CQ Mouse Anti-CCL4 Recombinant Antibody (NEUT-225CQ) WB, Neut, FC, CyTOF Mouse IgG1
CAT Product Name Application Type
NEUT-226CQ Mouse Anti-CCL4 Recombinant Antibody (clone CBL434) WB, CyTOF, ELISA(Cap), ICFC, Neut Mouse IgG2b
CAT Product Name Application Type
NEUT-227CQ Mouse Anti-CCL4 Recombinant Antibody (clone CBL573) WB, Neut Mouse IgG1
CAT Product Name Application Type
NEUT-228CQ Rat Anti-CCL4 Recombinant Antibody (clone CBL850) ELISA, Neut Rat IgG2
CAT Product Name Application Type
NEUT-229CQ Rat Anti-CCL4 Recombinant Antibody (clone CBL473) Neut Rat IgG2a
CAT Product Name Application Type
MOR-0509 Hi-Affi™ Rabbit Anti-CCL4 Recombinant Antibody (clone DS509AB) WB Rabbit IgG
CAT Product Name Application Type
VS-0923-FY33 Recombinant Mouse Anti-CCL4 Antibody (VS-0923-FY33) ELISA, WB Mouse IgG1
CAT Product Name Application Type
VS3-WK1792 Recombinant Rabbit Anti-CCL4 Capture Antibody (clone R06-2O6) ELISA Rabbit IgG
CAT Product Name Application Type
VS3-WK1793 Recombinant Rabbit Anti-CCL4 Detection Antibody (clone R08-5V7) ELISA Rabbit IgG
CAT Product Name Application Type
VS7-HM311 Mouse Anti-CCL4 Recombinant Antibody (clone 7C9E4) FCM Mouse IgG2b
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare