Chicken Anti-CCL4 Polyclonal IgY (CAT#: BRD-0886MZ)
This antibody is a chicken polyclonal antibody which specifically reacts with CCL4.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Neuronal cells
Staining:Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/7805/22731_B_7_5.jpg

(Leydig cells
Staining:Medium
Intensity: Moderate
Quantity:>75%
Location: Cytoplasmic/membranous)
* Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/7805/22731_A_6_6.jpg
Specifications
- Immunogen
- synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta
- Host Species
- Chicken
- Type
- Chicken antibody
- Species Reactivity
- Human
- Applications
- ELISA, WB
Target
- Alternative Names
- ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
- Gene ID
- 6351
- UniProt ID
- P13236
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "CCL4"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
NAB-386-sdAb | Recombinant Anti-Human CCL4 VHH Single Domain Antibody | IHC, IP, FC, Neut, FUNC | Llama VHH |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for BRD-0886MZ. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: FC, IP, ELISA, Neut, FuncS, IF, IHC
Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
Application: ELISA, IHC
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: WB, ELISA, FC, IHC, IP
Application: Neut, FC
Application: ELISA
Application: FC, FRET, Internalization
Application: WB, ELISA, Neut, FuncS
Application: ELISA, FC, IHC, Neut
Application: FC, IHC, Cyt, FuncS
Application: ELISA, Activ, Block
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.