Chicken Anti-CCL4 Polyclonal IgY (CAT#: BRD-0886MZ)

This antibody is a chicken polyclonal antibody which specifically reacts with CCL4.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Normal Tissue

Specifications

  • Immunogen
  • synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta
  • Host Species
  • Chicken
  • Type
  • Chicken antibody
  • Species Reactivity
  • Human
  • Applications
  • ELISA, WB

Target

  • Alternative Names
  • ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "CCL4"

Select a product category from the dropdown menu below to view related products.
Please select product type
Single Domain Antibody Products IgG Antibody Products Chicken IgY Antibody Products Neutralizing Antibody Products Rabbit Monoclonal Antibody Products
CAT Product Name Application Type
NAB-386-sdAb Recombinant Anti-Human CCL4 VHH Single Domain Antibody IHC, IP, FC, Neut, FUNC Llama VHH

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for BRD-0886MZ. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare