Chicken Anti-CCL4 Polyclonal IgY
CAT#: BRD-0886MZ
This antibody is a chicken polyclonal antibody which specifically reacts with CCL4.
Specifications
- Immunogen
- Synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, reflecting amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta
- Host Species
- Chicken
- Type
- Chicken antibody
- Antibody Isotype
- IgY
- Species Reactivity
- Human
- Applications
- ELISA, WB
Target
Customer Review
There are currently no Customer reviews or questions for BRD-0886MZ. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "CCL4"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NAB-386-sdAb | Recombinant Anti-Human CCL4 VHH Single Domain Antibody | IHC, IP, FC, Neut, FUNC | Llama VHH |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1453z | Mouse Anti-CCL4 Recombinant Antibody (clone 27F11) | WB, ELISA | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| BRD-0361MZ | Chicken Anti-MIP-1β Polyclonal IgY | Indirect ELISA, WB | Chicken antibody |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-225CQ | Mouse Anti-CCL4 Recombinant Antibody (NEUT-225CQ) | WB, Neut, FC, CyTOF | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-226CQ | Mouse Anti-CCL4 Recombinant Antibody (clone CBL434) | WB, CyTOF, ELISA(Cap), ICFC, Neut | Mouse IgG2b |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-227CQ | Mouse Anti-CCL4 Recombinant Antibody (clone CBL573) | WB, Neut | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-228CQ | Rat Anti-CCL4 Recombinant Antibody (clone CBL850) | ELISA, Neut | Rat IgG2 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-229CQ | Rat Anti-CCL4 Recombinant Antibody (clone CBL473) | Neut | Rat IgG2a |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0509 | Hi-Affi™ Rabbit Anti-CCL4 Recombinant Antibody (clone DS509AB) | WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0923-FY33 | Recombinant Mouse Anti-CCL4 Antibody (VS-0923-FY33) | ELISA, WB | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS3-WK1792 | Recombinant Rabbit Anti-CCL4 Capture Antibody (clone R06-2O6) | ELISA | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS3-WK1793 | Recombinant Rabbit Anti-CCL4 Detection Antibody (clone R08-5V7) | ELISA | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS7-HM311 | Mouse Anti-CCL4 Recombinant Antibody (clone 7C9E4) | FCM | Mouse IgG2b |
Popular Products

Application: FC, Cyt, Stim, PP, Agonist

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, WB

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.














