Mouse anti-Human ZCCHC13 Polyclonal Antibody (CAT#: MOB-0415ZL)

Mouse polyclonal antibody specifically binds to human ZCCHC13 antibody


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Datasheet
  • MSDS
  • COA

Specifications

  • Immunogen
  • ZCCHC13 (NP_976048.1, 1 a.a. ~ 166 a.a) full-length human protein. (Sequence:MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ
  • Host Species
  • Mouse
  • Species Reactivity
  • Human

Product Property

  • Purity
  • Protein G purified
  • Format
  • Liquid
  • Buffer
  • In 1x PBS, pH 7.4
  • Storage
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing

Target

  • Alternative Names
  • CNBP2, ZNF9L, Zinc finger CCHC-type containing 13

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for MOB-0415ZL. Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare