1 0
Cart
    Inquiry
    Popular Searches: Recombinant Antibody MHC Tetramer T cell Receptor Scaffold Protein

    Mouse Anti-LYPD3 scFv-Fc Chimera (VS-0425-FY148) (CAT#: VS-0425-FY148)

    The anti-LYPD3 scFv-FC is a recombinant fusion protein composed of a single-chain variable fragment (scFv) targeting LYPD3 (lymphocyte antigen 75) fused to a human IgG1 Fc region. This unique construct allows for high specificity and affinity towards the LYPD3 antigen, which is involved in various cellular processes such as immune responses and cancer progression.

    Specific Inquiry
    • Size:

    • Conjugation:

    • Endotoxin:

    • Purity:

    • Formats:

    • Isotype Switching:

    • Fc Engineering:

    • Modalities:

    Custom Production

    We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

    Sequences:
    Isotype :
    Purity :
    Endotoxin :
    Quantity :
    Conjugation :
    Fc Engineering :
    Modalities :
    Other Requirements:
    We require custom production
    • Gene Expression
    • Datasheet
    • MSDS
    • COA
    Subcellular Location and Protein Expression
    Figure 1 IF staining of human cell line RT4
    Figure 1 IF staining of human cell line RT4
    (Immunofluorescent staining of human cell line RT4 shows localization to vesicles.)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/77859/1748_H2_22_cr5805e03b68159_selected.jpg
    Normal Tissue
    Figure 2 IHC staining of human skin
    Figure 2 IHC staining of human skin
    (High expression. RNA expression: 669.3 nTPM)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41529/88166_B_7_1_val_selected.jpg
    Figure 3 IHC staining of human kidney
    Figure 3 IHC staining of human kidney
    (Low expression. RNA expression: 2.9 nTPM)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41529/88166_A_8_5_val_selected.jpg
    Figure 4 IHC staining of human esophagus
    Figure 4 IHC staining of human esophagus
    (High expression. RNA expression: 1066.8 nTPM)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_B_5_1_val_selected.jpg
    Figure 5 IHC staining of human skeletal muscle
    Figure 5 IHC staining of human skeletal muscle
    (Low expression. RNA expression: 2.8 nTPM)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_B_2_6_val_selected.jpg
    Figure 6 Cerebral cortex
    Figure 6 Cerebral cortex
    (Neuronal cells
    Staining: Not detected
    Intensity: Weak
    Quantity: <25%
    Location: Cytoplasmic/membranou)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_B_8_5.jpg
    Figure 7 Colon
    Figure 7 Colon
    (Glandular cells
    Staining: Medium
    Intensity: Moderate
    Quantity: 75%-25%
    Location: Cytoplasmic/membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_A_7_3.jpg
    Figure 8 Testis
    Figure 8 Testis
    (Leydig cells
    Staining: Not detected
    Intensity: Weak
    Quantity: <25%
    Location: Cytoplasmic/membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_A_6_6.jpg
    Figure 9 Lymph node
    Figure 9 Lymph node
    (Non-germinal center cells
    Staining: Medium
    Intensity: Strong
    Quantity: <25%
    Location: Cytoplasmic/membranous)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/images/41797/88184_A_8_8.jpg
    RNA Expression
    Figure 10 RNA cell line category: Cell line enhanced (CAPAN-2, HaCaT, MCF7, RT4, SK-BR-3)
    Figure 10 RNA cell line category: Cell line enhanced (CAPAN-2, HaCaT, MCF7, RT4, SK-BR-3)
    (Cell lines ordered by descending RNA expression order.)
    * Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000124466-LYPD3

    Specifications

    • Immunogen
    • The immunogen used to develop the antibody was an unconjugated antigenic peptide of C4.4A, specifically: CPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRL.
    • Host Species
    • Mouse
    • Type
    • Mouse IgG2b, scFv-Fc
    • Specificity
    • Human LYPD3
    • Species Reactivity
    • Human
    • Applications
    • ELISA, Blocking
    • Related Disease
    • Cancer

    Product Property

    • Purity
    • >95% as determined by SDS-PAGE
    • Concentration
    • Please refer to the vial label for the specific concentration.
    • Storage
    • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
    • Shipping
    • Ice packs

    Applications

    • Application Notes
    • The optimal dilution concentration is determined by the experiment.

    Target

    • Alternative Names
    • C4.4A
    • Long Name
    • LY6/PLAUR Domain Containing 3
    • Cellular Localization
    • Cell membrane
    • Post Translation Modifications
    • N-glycosylated and O-glycosylated.
      Glycosylation at Asn118, Asn163, Asn176, Asn183, Ser289, and Thr297
      Modification sites at PhosphoSitePlus
      Glycosylation from GlyGen 9 sites, 6 N-linked glycans (6 sites), 2 O-linked glycans (3 sites)
    • Function
    • Supports cell migration.
      May be involved in urothelial cell-matrix interactions.
      May be involved in tumor progression.

    Product Notes

    This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

    • Increased sensitivity
    • Confirmed specificity
    • High repeatability
    • Excellent batch-to-batch consistency
    • Sustainable supply
    • Animal-free production

    See more details about Hi-Affi™ recombinant antibody benefits.

    Downloads

    Download resources about recombinant antibody development and antibody engineering to boost your research.

    See other products for "LYPD3"

    Select a product category from the dropdown menu below to view related products.
    Please select product type
    Rabbit Monoclonal Antibody Products IgG Antibody Products ScFv Antibody Products Fab Antibody Products Extracellular Vesicle (EV) Antibody Products
    CAT Product Name Application Type
    MOR-2109 Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (DS2109AB) ELISA IgG
    MOR-4318 Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI407DS) FC IgG
    MOR-4319 Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI408DS) WB, ELISA, ICC/IF, IF, FC IgG
    MOR-4320 Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI409DS) FC IgG

    Customer Reviews and Q&As

    Submit a review or a question

    There are currently no Customer reviews or questions for VS-0425-FY148. Click the button above to contact us or submit your feedback about this product.

    Popular products with customers

    Figure 1 Anti-CD20 Antibody (TAB-772) in Flow Cytometry

    Human Anti-MS4A1 Recombinant Antibody (TAB-772) (CAT# TAB-772)
    Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

    Figure 1 Anti-P. aeruginosa psl Antibody in SDS-PAGE

    Recombinant Anti-P. aeruginosa psl Antibody (CAT# MOB-736)
    Application: WB, IP, FuncS

    Figure 1 Anti-CTLA4 Antibody (TAB-067) in WB

    Anti-Human CTLA4 Recombinant Antibody (TAB-067) (CAT# TAB-067)
    Application: WB, FuncS, IF, Neut, ELISA, FC, IP

    Figure 1 Anti-PCSK9 Antibody (TAB-H31) in ELISA

    Human Anti-PCSK9 Recombinant Antibody (TAB-H31) (CAT# TAB-H31)
    Application: FC, IP, ELISA, Neut, FuncS, IF, IHC

    Figure 1 Anti-Human TNF beta Antibody (TAB-071) in WB

    Anti-Human TNF beta Recombinant Antibody (TAB-071) (CAT# TAB-071)
    Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

    Figure 1 Recombinant Anti-S1P Antibody (TAB-H64) in SDS-PAGE

    Anti-Human S1P Recombinant Antibody (TAB-H64) (CAT# TAB-H64)
    Application: Inhib, ELISA

    Anti-C. difficile toxin B Therapeutic Antibody (bezlotoxumab) (TAB-725) in ELISA

    Anti-C. Diff Toxin B Recombinant Antibody (Bezlotoxumab) (CAT# TAB-725)
    Application: WB, FC, IP, ELISA, Neut, FuncS, IF

    Figure 1 Anti-Human FLT3 Therapeutic Antibody (TAB-291CL) in DB

    Anti-Human FLT3 Recombinant Antibody (IMC-EB10) (CAT# TAB-291CL)
    Application: WB, IHC, FC, Cyt, ELISA

    Figure 1 Anti-Human GAST Recombinant Antibody (TAB-300CL) in SDS-PAGE

    Anti-Human GAST Recombinant Antibody (XPA067.06) (CAT# TAB-300CL)
    Application:

    Figure 1 Anti-Human IL21R Recombinant Antibody (TAB- 416CL) in WB

    Anti-Human IL21R Recombinant Antibody (PF-05230900) (CAT# TAB-416CL)
    Application:

    Figure 1 Anti-Human SLAMF7 Recombinant Antibody (TAB-570CL) in WB

    Human Anti-SLAMF7 Recombinant Antibody (TAB-570CL) (CAT# TAB-570CL)
    Application: IF, IHC, Inhib

    Figure 1 Recombinant Anti-HIV env Antibody (PABL-179) in SDS-PAGE

    Human Anti-HIV-1 gp160 Recombinant Antibody (clone PGT128) (CAT# PABL-179)
    Application: WB, ELISA, FuncS

    Figure 1 Mouse Anti-VEGF Recombinant Antibody (PABW-130) in WB

    Mouse Anti-VEGF Recombinant Antibody (clone A4.6.1) (CAT# PABW-130)
    Application: Neut, ELISA, Inhib, ICC, WB

    Figure 1 Anti-Human CA9 Recombinant Antibody (TAB-1458CL) in SDS-PAGE

    Anti-Human CA9 Recombinant Antibody (MSC3) (CAT# TAB-1458CL)
    Application: FC

    Figure 1 Human Anti-RSV F Recombinant Antibody (MRO-878LC) in WB

    Human Anti-RSV F Recombinant Antibody (MRO-878LC) (CAT# MRO-878LC)
    Application: ELISA, Neut

    Figure 1 Rat Anti-CD38 Recombinant Antibody (NEUT-349CQ) in SDS-PAGE

    Rat Anti-CD38 Recombinant Antibody (clone NIMR-5) (CAT# NEUT-349CQ)
    Application: Neut, FC, IHC-Fr, IP, BA

    Figure 1 Human Anti-GPC3 Recombinant Antibody (HPAB-0563-CN) in SDS-PAGE

    Human Anti-GPC3 Recombinant Antibody (clone hGC33) (CAT# HPAB-0563-CN)
    Application: ELISA

    Figure 1 Recombinant Human Anti-HCV E2 Antibody (HPAB-0196CQ) in SDS-PAGE

    Recombinant Human Anti-HCV E2 Antibody (HPAB-0196CQ) (CAT# HPAB-0196CQ)
    Application: ELISA, Neut

    Figure 1 Mouse Anti-VEGFA Recombinant Antibody (clone mAb G6-31) (HPAB-0330CQ) in SDS-PAGE

    Mouse Anti-VEGFA Recombinant Antibody (clone mAb G6-31) (CAT# HPAB-0330CQ)
    Application: ELISA, IF, Block, FuncS

    Figure 1 Mouse Anti-ACTA2 Antibody (ZG-1036F) in IF

    Mouse Anti-ACTA2 Recombinant Antibody (clone HHF35) (CAT# ZG-1036F)
    Application: EM, ELISA, ICC, IHC-Fr, IHC-P, WB

    For Research Use Only. Not For Clinical Use.

    For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

    Send Inquiry

    This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

    Go to compare

    Go to compare