Mouse Anti-LYPD3 scFv-Fc Chimera (VS-0425-FY148)

CAT#: VS-0425-FY148

The anti-LYPD3 scFv-FC is a recombinant fusion protein composed of a single-chain variable fragment (scFv) targeting LYPD3 (lymphocyte antigen 75) fused to a human IgG1 Fc region. This unique construct allows for high specificity and affinity towards the LYPD3 antigen, which is involved in various cellular processes such as immune responses and cancer progression.

Gene Expression
Figure 1 IF staining of human cell line RT4 Figure 2 IHC staining of human skin Figure 3 IHC staining of human kidney Figure 4 IHC staining of human esophagus Figure 5 IHC staining of human skeletal muscle Figure 6 Cerebral cortex Figure 7 Colon Figure 8 Testis Figure 9 Lymph node Figure 10 RNA cell line category: Cell line enhanced (CAPAN-2, HaCaT, MCF7, RT4, SK-BR-3)

Specifications

  • Immunogen
  • The immunogen used to develop the antibody was an unconjugated antigenic peptide of C4.4A, specifically: CPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRL.
  • Host Species
  • Mouse
  • Type
  • Mouse IgG2b, scFv-Fc
  • Specificity
  • Human LYPD3
  • Species Reactivity
  • Human
  • Applications
  • ELISA, Blocking
  • Related Disease
  • Cancer

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Shipping
  • Ice packs

Applications

  • Application Notes
  • The optimal dilution concentration is determined by the experiment.

Target

  • Alternative Names
  • C4.4A
  • Long Name
  • LY6/PLAUR Domain Containing 3
  • Cellular Localization
  • Cell membrane
  • Post Translation Modifications
  • N-glycosylated and O-glycosylated.
    Glycosylation at Asn118, Asn163, Asn176, Asn183, Ser289, and Thr297
    Modification sites at PhosphoSitePlus
    Glycosylation from GlyGen 9 sites, 6 N-linked glycans (6 sites), 2 O-linked glycans (3 sites)
  • Function
  • Supports cell migration.
    May be involved in urothelial cell-matrix interactions.
    May be involved in tumor progression.
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for VS-0425-FY148. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "LYPD3"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
VS-0425-YC487 Recombinant Anti-LYPD3 Vesicular Antibody, EV Displayed (VS-0425-YC487) ELISA, FC, Cell-uptake
CAT Product Name Application Type
VS-0525-XY4144 Anti-LYPD3 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare