Mouse Anti-LYPD3 scFv-Fc Chimera (VS-0425-FY148)
CAT#: VS-0425-FY148
The anti-LYPD3 scFv-FC is a recombinant fusion protein composed of a single-chain variable fragment (scFv) targeting LYPD3 (lymphocyte antigen 75) fused to a human IgG1 Fc region. This unique construct allows for high specificity and affinity towards the LYPD3 antigen, which is involved in various cellular processes such as immune responses and cancer progression.
Specifications
- Immunogen
- The immunogen used to develop the antibody was an unconjugated antigenic peptide of C4.4A, specifically: CPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRL.
- Host Species
- Mouse
- Type
- Mouse IgG2b, scFv-Fc
- Specificity
- Human LYPD3
- Species Reactivity
- Human
- Applications
- ELISA, Blocking
- Related Disease
- Cancer
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
- Shipping
- Ice packs
Applications
- Application Notes
- The optimal dilution concentration is determined by the experiment.
Target
- Alternative Names
- C4.4A
- Gene ID
- 27076
- UniProt ID
- O95274
- Long Name
- LY6/PLAUR Domain Containing 3
- Cellular Localization
- Cell membrane
- Post Translation Modifications
- N-glycosylated and O-glycosylated.
Glycosylation at Asn118, Asn163, Asn176, Asn183, Ser289, and Thr297
Modification sites at PhosphoSitePlus
Glycosylation from GlyGen 9 sites, 6 N-linked glycans (6 sites), 2 O-linked glycans (3 sites)
- Protein Refseq
- NP_055215.2
- Function
- Supports cell migration.
May be involved in urothelial cell-matrix interactions.
May be involved in tumor progression.
Customer Review
There are currently no Customer reviews or questions for VS-0425-FY148. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "LYPD3"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2109 | Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (DS2109AB) | ELISA | IgG |
| MOR-4318 | Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI407DS) | FC | IgG |
| MOR-4319 | Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI408DS) | WB, ELISA, ICC, IF, IF, FC | IgG |
| MOR-4320 | Hi-Affi™ Recombinant Rabbit Anti-LYPD3 Monoclonal Antibody (SI409DS) | FC | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0032CQ | Human Anti-LYPD3 Recombinant Antibody (HPAB-0032CQ) | ELISA, WB, FC, FuncS | Human IgG1, λ |
| HPAB-0033CQ | Human Anti-LYPD3 Recombinant Antibody (HPAB-0033CQ) | ELISA, WB, FC, IF, FuncS | Human IgG1, λ |
| HPAB-0483-FY | Mouse Anti-LYPD3 Recombinant Antibody (HPAB-0483-FY) | ELISA, Block | Mouse IgG2b, κ |
| HPAB-J0170-YC | Human Anti-LYPD3 Recombinant Antibody (HPAB-J0170-YC) | ELISA, FC | Human IgG1 |
| HPAB-J0171-YC | Human Anti-LYPD3 Recombinant Antibody (HPAB-J0171-YC) | ELISA, FC | Human IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0032CQ-S(P) | Human Anti-LYPD3 Recombinant Antibody scFv Fragment (HPAB-0032CQ-S(P)) | ELISA, WB, FC | Human scFv |
| HPAB-0033CQ-S(P) | Human Anti-LYPD3 Recombinant Antibody scFv Fragment (HPAB-0033CQ-S(P)) | ELISA, WB, FC | Human scFv |
| HPAB-J0170-YC-S(P) | Human Anti-LYPD3 Recombinant Antibody scFv Fragment (HPAB-J0170-YC-S(P)) | ELISA, FC | Human scFv |
| HPAB-J0171-YC-S(P) | Human Anti-LYPD3 Recombinant Antibody scFv Fragment (HPAB-J0171-YC-S(P)) | ELISA, FC | Human scFv |
| HPAB-J0172-YC-S(P) | Human Anti-LYPD3 Recombinant Antibody scFv Fragment (HPAB-J0172-YC-S(P)) | ELISA, FC | Human scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0032CQ-F(E) | Human Anti-LYPD3 Recombinant Antibody Fab Fragment (HPAB-0032CQ-F(E)) | ELISA, WB, FC | Human Fab |
| HPAB-0033CQ-F(E) | Human Anti-LYPD3 Recombinant Antibody Fab Fragment (HPAB-0033CQ-F(E)) | ELISA, WB, FC | Human Fab |
| HPAB-0483-FY-F(E) | Mouse Anti-LYPD3 Recombinant Antibody; Fab Fragment (HPAB-0483-FY-F(E)) | ELISA, Block | Mouse Fab, κ |
| HPAB-J0170-YC-F(E) | Human Anti-LYPD3 Recombinant Antibody Fab Fragment (HPAB-J0170-YC-F(E)) | ELISA, FC | Human Fab |
| HPAB-J0171-YC-F(E) | Human Anti-LYPD3 Recombinant Antibody Fab Fragment (HPAB-J0171-YC-F(E)) | ELISA, FC | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC487 | Recombinant Anti-LYPD3 Vesicular Antibody, EV Displayed (VS-0425-YC487) | ELISA, FC, Cell-uptake |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4144 | Anti-LYPD3 Immunohistochemistry Kit | IHC |
Popular Products

Application: WB, IF, IP, Neut, FuncS, ELISA, FC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: Neut, ELISA, FuncS
-YJ5.png)
Application: WB, ELISA, FC, IHC, IP

Application: FC, IHC-Fr, IP, ELISA, Block

Application: ELISA, IHC, FC, IP, IF, FuncS
-2.png)
Application: ELISA

Application: ELISA, FC, Inhib, IHC-Fr, WB, IP
-2.png)
Application: ELISA
-2.png)
Application: WB, ELISA, FuncS

Application: IF, ICC, WB, IHC-P, IP

Application: WB, IHC-Fr, IHC-P, ICC, IF
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.










