Recombinant Human Anti-C5AR1 Antibody
CAT#: EPAF-1006LC
This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.
Specifications
- Host Species
- Human
- Type
- IgG
- Specificity
- Human C5a anaphylatoxin chemotactic receptor
- Species Reactivity
- Human
- Applications
- Blocking
Target
Customer Review
There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "C5AR1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1388CL | Mouse Anti-C5AR1 Recombinant Antibody (TAB-1388CL) | ELISA, Inhib | Mouse IgG3, κ |
| TAB-1389CL | Mouse Anti-C5AR1 Recombinant Antibody (TAB-1389CL) | ELISA, FC, Inhib | Mouse IgG2a, κ |
| TAB-1390CL | Mouse Anti-C5AR1 Recombinant Antibody (TAB-1390CL) | ELISA, Inhib | Mouse IgG2b, κ |
| TAB-1388CL-S(P) | Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1388CL-S(P)) | ELISA, Inhib | Mouse scFv |
| TAB-1389CL-S(P) | Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1389CL-S(P)) | ELISA, FC, Inhib | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1384CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1384CL-S(P)) | FC, Inhib | Human scFv |
| TAB-1385CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1385CL-S(P)) | FuncS | Human scFv |
| TAB-1386CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1386CL-S(P)) | FC, Inhib | Human scFv |
| TAB-1387CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1387CL-S(P)) | Inhib | Human scFv |
| TAB-1384CL-F(E) | Human Anti-C5AR1 Recombinant Antibody; Fab Fragment (TAB-1384CL-F(E)) | FC, Inhib | Human Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-093CQ | Recombinant Mouse Anti-C5AR1 Antibody | FC, IHC, Neut | IgG2a |
| NEUT-094CQ | Mouse Anti-C5AR1 Recombinant Antibody (clone CBL266) | Neut, FC, ELISA | Mouse IgG2a |
| NEUT-095CQ | Mouse Anti-C5AR1 Recombinant Antibody (clone CBL218) | FC, IHC, Neut | Mouse IgG2a |
| NEUT-096CQ | Mouse Anti-C5AR1 Recombinant Antibody (clone CBL759) | FC, CyTOF, Neut | Mouse IgG2a |
| NEUT-098CQ | Rat Anti-C5AR1 Recombinant Antibody (clone CBL744) | WB, ELISA(Cap), Neut | Rat IgG2a |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| NEUT-097CQ | Rat Anti-C5AR1 Recombinant Antibody (clone 20/70) | FC, Block | Rat IgG2b, κ |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-0418 | Hi-Affi™ Rabbit Anti-C5AR1 Recombinant Antibody (clone DS418AB), PE | FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0143-CN | Rabbit Anti-C5AR1 Recombinant Antibody (HPAB-0143-CN) | ELISA, FC | Rabbit IgG |
| HPAB-M0019-YC | Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0019-YC) | ELISA, FC, Block | Mouse IgG |
| HPAB-M0020-YC | Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0020-YC) | ELISA, FC, Block | Mouse IgG |
| HPAB-M0021-YC | Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0021-YC) | ELISA, FC, Block | Mouse IgG |
| FAMAB-1724CQ | Mouse Anti-C5AR1 Recombinant Antibody (clone D10) | WB, ELISA | Mouse IgG1 |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0143-CN-S(P) | Rabbit Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-0143-CN-S(P)) | ELISA, FC | Rabbit scFv |
| HPAB-M0019-YC-S(P) | Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0019-YC-S(P)) | ELISA, FC, Block | Mouse scFv |
| HPAB-M0020-YC-S(P) | Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0020-YC-S(P)) | ELISA, FC, Block | Mouse scFv |
| HPAB-M0021-YC-S(P) | Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0021-YC-S(P)) | ELISA, FC, Block | Mouse scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0143-CN-F(E) | Rabbit Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-0143-CN-F(E)) | ELISA, FC | Rabbit Fab |
| HPAB-M0019-YC-F(E) | Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0019-YC-F(E)) | ELISA, FC, Block | Mouse Fab |
| HPAB-M0020-YC-F(E) | Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0020-YC-F(E)) | ELISA, FC, Block | Mouse Fab |
| HPAB-M0021-YC-F(E) | Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0021-YC-F(E)) | ELISA, FC, Block | Mouse Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| EPAF-0571CQ | Human Anti-C5AR1 Recombinant Antibody (clone Fab400) | ELISA | Human IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0225-XY8 | CytoStream™ Mouse Anti-C5AR1 Recombinant Antibody (VS-0225-XY8) | FC, IF | Mouse IgG1, kappa |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY285 | Anti-C5AR1 Immunohistochemistry Kit | IHC | |
| VS-0525-XY891 | Anti-Mouse C5AR1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-FY35 | Human Anti-C5AR1 scFv-Fc Chimera (VS-0425-FY35) | ELISA, FC | Human IgG1, scFv-Fc |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0425-YC251 | Recombinant Anti-C5AR1 Vesicular Antibody, EV Displayed (VS-0425-YC251) | ELISA, FC, Inhib, Cell-uptake |
Popular Products

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: ELISA, Neut, IF, IP, FC, FuncS
-2.png)
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC

Application: ELISA, FC, IP, FuncS, IF, Neut, ICC

Application: Neut, FC

Application: ELISA, IHC, FC, IP, IF, Inhib

Application: ELISA, Neut
-4.jpg)
Application: FC

Application: ELISA, FC

Application: ELISA, FC, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.












