Recombinant Human Anti-C5AR1 Antibody (CAT#: EPAF-1006LC)

This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.

Specific Inquiry
  • Size:

  • Conjugation:

  • Endotoxin:

  • Purity:

  • Formats:

  • Isotype Switching:

  • Fc Engineering:

  • Modalities:

Custom Production

We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

Sequences:
Isotype :
Purity :
Endotoxin :
Quantity :
Conjugation :
Fc Engineering :
Modalities :
Other Requirements:
We require custom production
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Host Species
  • Human
  • Type
  • IgG
  • Specificity
  • Human C5a anaphylatoxin chemotactic receptor
  • Species Reactivity
  • Human
  • Applications
  • Blocking

Target

  • Alternative Names
  • C5AR1; complement C5a receptor 1; C5A; C5AR; C5R1; CD88

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "C5AR1"

Select a product category from the dropdown menu below to view related products.
Please select product type
Human Antibody Products Mouse Antibody Products IgG Antibody Products Neutralizing Antibody Products Blocking Antibody Products Rabbit Monoclonal Antibody Products ScFv Antibody Products Fab Antibody Products Epitope-Specific Antibody Products Flow Cytometry (FC) related Reagents and Kits: Empowering Cell Function Research IHC Kit and Antibody Products: Precision Tools for Immunohistochemistry ScFv-Fc Chimera Products Extracellular Vesicle (EV) Antibody Products

Customer Reviews and Q&As

Submit a review or a question

There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.

Popular products with customers


For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare