Recombinant Human Anti-C5AR1 Antibody (CAT#: EPAF-1006LC)
This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus & vesicles.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/48012/1916_B12_32_selected.jpg

(Neuropil Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_7_5.jpg

(Endothelial cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_A_8_3.jpg

(Hematopoietic cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_5_4.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000197405-C5AR1
Specifications
- Host Species
- Human
- Type
- IgG
- Specificity
- Human C5a anaphylatoxin chemotactic receptor
- Species Reactivity
- Human
- Applications
- Blocking
Target
- Alternative Names
- C5AR1; complement C5a receptor 1; C5A; C5AR; C5R1; CD88
- Gene ID
- 728
- UniProt ID
- P21730
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "C5AR1"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-1384CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1384CL-S(P)) | FC, Inhib | Human scFv |
TAB-1384CL-F(E) | Human Anti-C5AR1 Recombinant Antibody; Fab Fragment (TAB-1384CL-F(E)) | FC, Inhib | Human Fab |
TAB-1385CL-F(E) | Human Anti-C5AR1 Recombinant Antibody; Fab Fragment (TAB-1385CL-F(E)) | FuncS | Human Fab |
TAB-1386CL-F(E) | Human Anti-C5AR1 Recombinant Antibody; Fab Fragment (TAB-1386CL-F(E)) | FC, Inhib | Human Fab |
TAB-1387CL-F(E) | Human Anti-C5AR1 Recombinant Antibody; Fab Fragment (TAB-1387CL-F(E)) | Inhib | Human Fab |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, ICC
Application: WB, ELISA, IP, FC, FuncS, Neut, IF
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, IHC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: Neut, ELISA, IF, IP, FuncS, FC, WB
Application: Neut, ELISA, FuncS
Application: ELISA, IP, WB, IHC, IF, FuncS
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, FC, IF, WB
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: FC, FuncS, IA, IF, IP, IHC
Application: ELISA, FuncS, Neut, IF, WB, EM, Inhib, IHC
Application: ELISA, WB
Application: Inhib, FC, WB
For Research Use Only. Not For Clinical Use.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.