Recombinant Human Anti-C5AR1 Antibody

CAT#: EPAF-1006LC

This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.

Gene Expression
Figure 1 IF staining of human cell line HeLa Figure 2 Cerebral cortex Figure 3 Colon Figure 4 Bone marrow Figure 5 RNA cell line category: Cell line enhanced (A549, CAPAN-2, HMC-1, U-87 MG, U-937)

Specifications

  • Host Species
  • Human
  • Type
  • IgG
  • Specificity
  • Human C5a anaphylatoxin chemotactic receptor
  • Species Reactivity
  • Human
  • Applications
  • Blocking

Target

  • Alternative Names
  • C5AR1; complement C5a receptor 1; C5A; C5AR; C5R1; CD88
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "C5AR1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
TAB-1384CL Human Anti-C5AR1 Recombinant Antibody (TAB-1384CL) FC, Inhib Human IgG
CAT Product Name Application Type
TAB-1385CL Human Anti-C5AR1 Recombinant Antibody (TAB-1385CL) FuncS Human IgG
CAT Product Name Application Type
TAB-1386CL Human Anti-C5AR1 Recombinant Antibody (TAB-1386CL) FC, Inhib Human IgG
CAT Product Name Application Type
TAB-1387CL Human Anti-C5AR1 Recombinant Antibody (TAB-1387CL) Inhib Human IgG
CAT Product Name Application Type
TAB-1388CL Mouse Anti-C5AR1 Recombinant Antibody (TAB-1388CL) ELISA, Inhib Mouse IgG3, κ
CAT Product Name Application Type
TAB-1389CL Mouse Anti-C5AR1 Recombinant Antibody (TAB-1389CL) ELISA, FC, Inhib Mouse IgG2a, κ
CAT Product Name Application Type
TAB-1390CL Mouse Anti-C5AR1 Recombinant Antibody (TAB-1390CL) ELISA, Inhib Mouse IgG2b, κ
CAT Product Name Application Type
TAB-1384CL-S(P) Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1384CL-S(P)) FC, Inhib Human scFv
CAT Product Name Application Type
TAB-1388CL-S(P) Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1388CL-S(P)) ELISA, Inhib Mouse scFv
CAT Product Name Application Type
TAB-1389CL-S(P) Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1389CL-S(P)) ELISA, FC, Inhib Mouse scFv
CAT Product Name Application Type
MOB-0677MZ Mouse Anti-C5AR1 Recombinant Antibody (clone Q23/2) FC, WB Mouse IgG2a
CAT Product Name Application Type
NEUT-093CQ Recombinant Mouse Anti-C5AR1 Antibody FC, IHC, Neut IgG2a
CAT Product Name Application Type
NEUT-094CQ Mouse Anti-C5AR1 Recombinant Antibody (clone CBL266) Neut, FC, ELISA Mouse IgG2a
CAT Product Name Application Type
NEUT-095CQ Mouse Anti-C5AR1 Recombinant Antibody (clone CBL218) FC, IHC, Neut Mouse IgG2a
CAT Product Name Application Type
NEUT-096CQ Mouse Anti-C5AR1 Recombinant Antibody (clone CBL759) FC, CyTOF, Neut Mouse IgG2a
CAT Product Name Application Type
NEUT-097CQ Rat Anti-C5AR1 Recombinant Antibody (clone 20/70) FC, Block Rat IgG2b, κ
CAT Product Name Application Type
NEUT-098CQ Rat Anti-C5AR1 Recombinant Antibody (clone CBL744) WB, ELISA(Cap), Neut Rat IgG2a
CAT Product Name Application Type
HPAB-0143-CN Rabbit Anti-C5AR1 Recombinant Antibody (HPAB-0143-CN) ELISA, FC Rabbit IgG
CAT Product Name Application Type
EPAF-0571CQ Human Anti-C5AR1 Recombinant Antibody (clone Fab400) ELISA Human IgG
CAT Product Name Application Type
HPAB-M0019-YC Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0019-YC) ELISA, FC, Block Mouse IgG
CAT Product Name Application Type
HPAB-M0020-YC Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0020-YC) ELISA, FC, Block Mouse IgG
CAT Product Name Application Type
HPAB-M0021-YC Mouse Anti-C5AR1 Recombinant Antibody (HPAB-M0021-YC) ELISA, FC, Block Mouse IgG
CAT Product Name Application Type
HPAB-M0019-YC-S(P) Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0019-YC-S(P)) ELISA, FC, Block Mouse scFv
CAT Product Name Application Type
HPAB-M0020-YC-S(P) Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0020-YC-S(P)) ELISA, FC, Block Mouse scFv
CAT Product Name Application Type
HPAB-M0021-YC-S(P) Mouse Anti-C5AR1 Recombinant Antibody; scFv Fragment (HPAB-M0021-YC-S(P)) ELISA, FC, Block Mouse scFv
CAT Product Name Application Type
HPAB-M0019-YC-F(E) Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0019-YC-F(E)) ELISA, FC, Block Mouse Fab
CAT Product Name Application Type
HPAB-M0020-YC-F(E) Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0020-YC-F(E)) ELISA, FC, Block Mouse Fab
CAT Product Name Application Type
HPAB-M0021-YC-F(E) Mouse Anti-C5AR1 Recombinant Antibody; Fab Fragment (HPAB-M0021-YC-F(E)) ELISA, FC, Block Mouse Fab
CAT Product Name Application Type
VS-0225-XY8 CytoStream™ Mouse Anti-C5AR1 Recombinant Antibody (VS-0225-XY8) FC, IF Mouse IgG1, kappa
CAT Product Name Application Type
VS-0325-XY285 Anti-C5AR1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0425-FY35 Human Anti-C5AR1 scFv-Fc Chimera (VS-0425-FY35) ELISA, FC Human IgG1, scFv-Fc
CAT Product Name Application Type
VS-0425-YC251 Recombinant Anti-C5AR1 Vesicular Antibody, EV Displayed (VS-0425-YC251) ELISA, FC, Inhib, Cell-uptake
CAT Product Name Application Type
VS-0525-XY891 Anti-Mouse C5AR1 Immunohistochemistry Kit IHC
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare