Recombinant Human Anti-C5AR1 Antibody (CAT#: EPAF-1006LC)
This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.
Specific Inquiry
Custom Production
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.
We require custom production
Subcellular Location
Normal Tissue
RNA Expression
Figure 1 IF staining of human cell line HeLa
(Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus & vesicles.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/48012/1916_B12_32_selected.jpg
(Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus & vesicles.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/48012/1916_B12_32_selected.jpg
Figure 2 Cerebral cortex
(Neuropil Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_7_5.jpg
(Neuropil Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_7_5.jpg
Figure 3 Colon
(Endothelial cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_A_8_3.jpg
(Endothelial cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_A_8_3.jpg
Figure 4 Bone marrow
(Hematopoietic cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_5_4.jpg
(Hematopoietic cells Staining: High Intensity: Strong Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14520/33409_B_5_4.jpg
Figure 5 RNA cell line category: Cell line enhanced (A549, CAPAN-2, HMC-1, U-87 MG, U-937)
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000197405-C5AR1
(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000197405-C5AR1
Specifications
- Host Species
- Human
- Type
- IgG
- Specificity
- Human C5a anaphylatoxin chemotactic receptor
- Species Reactivity
- Human
- Applications
- Blocking
Target
- Alternative Names
- C5AR1; complement C5a receptor 1; C5A; C5AR; C5R1; CD88
- Gene ID
- 728
- UniProt ID
- P21730
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "C5AR1"
Select a product category from the dropdown menu below to view related products.
Please select product type
Human Antibodies
Mouse Antibodies
Neutralizing Antibodies
Blocking Antibodies
Rabbit Monoclonal Antibodies
ScFv Antibodies
Fab Antibodies
Epitope-Specific Antibodies
IgG Antibodies
FC Reagents & Kits
IHC Kits & Antibodies
ScFv-Fc Chimeras
Extracellular Vesicle Antibodies
| CAT | Product Name | Application | Type |
|---|---|---|---|
| TAB-1384CL | Human Anti-C5AR1 Recombinant Antibody (TAB-1384CL) | FC, Inhib | Human IgG |
| TAB-1385CL | Human Anti-C5AR1 Recombinant Antibody (TAB-1385CL) | FuncS | Human IgG |
| TAB-1386CL | Human Anti-C5AR1 Recombinant Antibody (TAB-1386CL) | FC, Inhib | Human IgG |
| TAB-1387CL | Human Anti-C5AR1 Recombinant Antibody (TAB-1387CL) | Inhib | Human IgG |
| TAB-1384CL-S(P) | Human Anti-C5AR1 Recombinant Antibody; scFv Fragment (TAB-1384CL-S(P)) | FC, Inhib | Human scFv |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for EPAF-1006LC. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: ELISA, IP, FC, FuncS, Neut, IF, ICC
-2-1.png)
Application: ELISA
Application: ELISA, FuncS, IHC, IF, FC, ADCC
Application: ELISA, FuncS
Application: ELISA, FC, IHC, Neut
Application: ELISA, Vaccine, FuncS
For Research Use Only. Not For Clinical Use.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
