Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0131-CN)

CAT#: HPAB-0131-CN

This product is a recombinant rabbit antibody that recognizes MZB1. This antibody can mediate the inhibition of PACAP38-driven cAMP production via VPAC2-R-expressing CHO-K1 cells. The affinity for PACAP38 is 0.027 nM.

Gene Expression
Figure 1 IF staining of human cell line REH Figure 2 Low expression in placenta Figure 3 Colon Figure 4 Lymph node Figure 5 RNA cell line category: Group enriched (Karpas-707, RPMI-8226)

Specifications

  • Immunogen
  • Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
  • Host Species
  • Rabbit
  • Type
  • Rabbit IgG
  • Specificity
  • Human MZB1
  • Species Reactivity
  • Human
  • Applications
  • ELISA, FC

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • PACAP; pERp1; MEDA-7
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for HPAB-0131-CN. Click the button above to contact us or submit your feedback about this product.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

See other products for "MZB1"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
MOB-1539z Rabbit Anti-MZB1 Recombinant Antibody (MOB-1539z) WB Rabbit IgG
CAT Product Name Application Type
MOB-1539z-F(E) Recombinant Anti-Human MZB1 Antibody Fab Fragment ELISA, FuncS Fab
CAT Product Name Application Type
MOB-1539z-S(P) Recombinant Anti-Human MZB1 Antibody scFv Fragment ELISA, WB, Neut, FuncS scFv
CAT Product Name Application Type
HPAB-0132-CN Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0132-CN) ELISA, FC Rabbit IgG
CAT Product Name Application Type
VS-0724-YC1176 AbPlus™ Anti-MZB1 Magnetic Beads (VS-0724-YC1176) IP, Protein Purification
CAT Product Name Application Type
VS-0325-XY1445 Anti-MZB1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0525-XY4666 Anti-Human MZB1 Immunohistochemistry Kit IHC
CAT Product Name Application Type
VS-0625-YC234 Recombinant Anti-MZB1 Eliminating Antibody, pH-Sensitive (VS-0625-YC234) Antigen-Sweeping In Vivo. Rabbit IgG
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare