Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0131-CN)
CAT#: HPAB-0131-CN
This product is a recombinant rabbit antibody that recognizes MZB1. This antibody can mediate the inhibition of PACAP38-driven cAMP production via VPAC2-R-expressing CHO-K1 cells. The affinity for PACAP38 is 0.027 nM.
Specifications
- Immunogen
- Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
- Host Species
- Rabbit
- Type
- Rabbit IgG
- Specificity
- Human MZB1
- Species Reactivity
- Human
- Applications
- ELISA, FC
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Customer Review
There are currently no Customer reviews or questions for HPAB-0131-CN. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
See other products for "MZB1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z | Rabbit Anti-MZB1 Recombinant Antibody (MOB-1539z) | WB | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z-F(E) | Recombinant Anti-Human MZB1 Antibody Fab Fragment | ELISA, FuncS | Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z-S(P) | Recombinant Anti-Human MZB1 Antibody scFv Fragment | ELISA, WB, Neut, FuncS | scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2354 | Hi-Affi™ Recombinant Rabbit Anti-MZB1 Monoclonal Antibody (DS2354AB) | WB, IP | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0132-CN | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0132-CN) | ELISA, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0131-CN-S(P) | Rabbit Anti-MZB1 Recombinant Antibody; scFv Fragment (HPAB-0131-CN-S(P)) | ELISA, FC | Rabbit scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0132-CN-S(P) | Rabbit Anti-MZB1 Recombinant Antibody; scFv Fragment (HPAB-0132-CN-S(P)) | ELISA, FC | Rabbit scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0131-CN-F(E) | Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0131-CN-F(E)) | ELISA, FC | Rabbit Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| HPAB-0132-CN-F(E) | Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0132-CN-F(E)) | ELISA, FC | Rabbit Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC1176 | AbPlus™ Anti-MZB1 Magnetic Beads (VS-0724-YC1176) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY1445 | Anti-MZB1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0525-XY4666 | Anti-Human MZB1 Immunohistochemistry Kit | IHC |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0625-YC234 | Recombinant Anti-MZB1 Eliminating Antibody, pH-Sensitive (VS-0625-YC234) | Antigen-Sweeping In Vivo. | Rabbit IgG |
Popular Products

Application: WB, FuncS, IF, Neut, ELISA, FC, IP

Application: ELISA, IP, FC, FuncS, Neut, IF, ICC

Application: FuncS, IF, Neut, ELISA, FC, IP, IHC

Application: IF, IP, Neut, FuncS, ELISA, FC, WB

Application: Neut, ELISA, IF, IP, FuncS, FC, ICC

Application: IP, IF, FuncS, FC, Neut, ELISA, ICC

Application: WB, ELISA, FC, IP, FuncS, IF, Neut

Application: IF, IP, Neut, FuncS, ELISA, FC, ICC

Application: ELISA, WB, BLI, SPR

Application: Neut, ELISA, FuncS
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.













