Recombinant Anti-MZB1 Eliminating Antibody, pH-Sensitive (VS-0625-YC234)
CAT#: VS-0625-YC234
The anti-MZB1 eliminating antibody is an engineered pH-sensitive antibody against human MZB1. MZB1 acts as a cytokine affecting inflammation and insulin response. The antibody has a novel MZB1-sweeping activity in vivo, which selectively eliminatesthe soluble MZB1 from plasma. Compared to conventional antibody, the mAb exerted in vivo efficacy by simultaneously engineering both pH-dependent antigen binding, to mimic the pH-dependent receptor-ligand binding of such endocytic receptors, and increased FcRn binding affinity at neutral pH, to mimic the cell-bound form of the receptors.
Gene Expression
Subcellular Location
Figure 1 IF staining of human cell line REH
Immunofluorescent staining of human cell line REH shows localization to the Golgi apparatus.
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/52694/2006_D6_1_selected.jpg
Normal Tissue
Figure 2 Low expression in placenta
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_3_7_val_selected.jpg
Normal Tissue
Figure 3 Colon
Enterocytes - Mucosal lymphoid cells Staining: Medium Intensity: Strong Quantity: <25%
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_9_3.jpg
Normal Tissue
Figure 4 Lymph node
Germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous Non-germinal center cells Staining: Medium Intensity: Strong Quantity: <25% Location: Cytoplasmic/ membranous
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/images/43745/99679_A_7_8.jpg
RNA Expression
Figure 5 RNA cell line category: Group enriched (Karpas-707, RPMI-8226)
Cell lines ordered by descending RNA expression order.
* Image credit: Image credit: Human Protein Atlas https://v21.proteinatlas.org/ENSG00000170476-MZB1
❮
❯
Specifications
- Immunogen
- Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
- Host Species
- Rabbit
- Type
- Rabbit IgG
- Specificity
- Human MZB1
- Species Reactivity
- Human
- Applications
- Antigen-Sweeping In Vivo.
Product Property
- Purification
- Protein A/G purified
- Purity
- >95%
- Format
- Liquid
- Buffer
- PBS only
- Preservative
- None
- Storage
- Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
REVIEWS AND Q&AS
CITATIONS
RESOURCES
DOWNLOADS
RELATED PRODUCTS
Inquiry
Navs
Customer Review
There are currently no Customer reviews or questions for VS-0625-YC234. Click the button above to contact us or submit your feedback about this product.
Submit Your Publication
Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.
Downloadable Resources
Download resources about recombinant antibody development and antibody engineering to boost your research.
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Datasheet
MSDS
COA
Certificate of Analysis LookupTo download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number:
See other products for "MZB1"
Select a product category from the dropdown menu below to view related products.
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z | Rabbit Anti-MZB1 Recombinant Antibody (MOB-1539z) | WB | Rabbit IgG |
| HPAB-0131-CN | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0131-CN) | ELISA, FC | Rabbit IgG |
| HPAB-0132-CN | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0132-CN) | ELISA, FC | Rabbit IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z-F(E) | Recombinant Anti-Human MZB1 Antibody Fab Fragment | ELISA, FuncS | Fab |
| HPAB-0131-CN-F(E) | Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0131-CN-F(E)) | ELISA, FC | Rabbit Fab |
| HPAB-0132-CN-F(E) | Rabbit Anti-MZB1 Recombinant Antibody; Fab Fragment (HPAB-0132-CN-F(E)) | ELISA, FC | Rabbit Fab |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOB-1539z-S(P) | Recombinant Anti-Human MZB1 Antibody scFv Fragment | ELISA, WB, Neut, FuncS | scFv |
| HPAB-0131-CN-S(P) | Rabbit Anti-MZB1 Recombinant Antibody; scFv Fragment (HPAB-0131-CN-S(P)) | ELISA, FC | Rabbit scFv |
| HPAB-0132-CN-S(P) | Rabbit Anti-MZB1 Recombinant Antibody; scFv Fragment (HPAB-0132-CN-S(P)) | ELISA, FC | Rabbit scFv |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| MOR-2354 | Hi-Affi™ Recombinant Rabbit Anti-MZB1 Monoclonal Antibody (DS2354AB) | WB, IP | IgG |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0724-YC1176 | AbPlus™ Anti-MZB1 Magnetic Beads (VS-0724-YC1176) | IP, Protein Purification |
| CAT | Product Name | Application | Type |
|---|---|---|---|
| VS-0325-XY1445 | Anti-MZB1 Immunohistochemistry Kit | IHC | |
| VS-0525-XY4666 | Anti-Human MZB1 Immunohistochemistry Kit | IHC |
Specific Inquiry
Add to compare
See Our Custom Production in Action
Popular Products
Application: WB, FC, IP, ELISA, Neut, FuncS, IF
Application: IF, IP, Neut, FuncS, ELISA, FC, WB
Application: IP, IF, FuncS, FC, Neut, ELISA, ICC
Application: FuncS, IF, Neut, ELISA, FC, IP, IHC
Application: ELISA, WB, BLI, SPR
Application: Neut, Inhib, FC, ELISA
-3.jpg)
Application: WB, ELISA, IF, FuncS, Apop, BA
Application: WB, ELISA, FuncS, IB, FC, SPR, Apop
Application: ELISA, FuncS
Application: Inhib, FC, WB
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
Send Inquiry
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
