
Recombinant Anti-PTH Single Domain Antibody (PTH22) (FAMAB-0323YC-VHH)

Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH22, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD). PTH22 bind to the PTH peptide antigen as PTH50 but only effectively when biotinylated
peptide is in complex with streptavidin.      

  • Datasheet

Naïve llama sdAb library
Llama VHH
Human PTH
Species Reactivity
Related Disease
Alternative Names
Entrez Gene ID
UniProt ID

For lab research use only, not for diagnostic, therapeutic or any in vivo human use.

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us
Send Inquiry Now!
* Phone:
* E-mail Address:
* Service & Products Interested:
Project Description:
* Verification Code:
Verification code
Click image to refresh the verification code.

Contact Us to Order
Tel: 1-631-381-2994
Fax: 1-631-207-8356

Increase Efficiency to Accelerate Your Research & Discovery Process

Increase Efficiency to Accelerate Your Research & 
Discovery Process

Creative Biolabs is the leading custom service provider that has extensive experience in various antibody production and engineering fields. Our service portfolio includes mouse and rat monoclonal antibody production ...

Find out more >


45-1 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-381-2994
Fax: 1-631-207-8356


Tel: 44-207-097-1828
Follow us on:

Terms of Service-Privacy Policy     © 2007 - 2019 Creative-Biolabs All Rights Reserved