Recombinant Llama Anti-PTH Single Domain Antibody (PTH22) (CAT#: FAMAB-0323YC-VHH)

Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH22, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD). PTH22 bind to the PTH peptide antigen as PTH50 but only effectively when biotinylated
peptide is in complex with streptavidin.

Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Datasheet
  • MSDS
  • COA


  • Host Species
  • Llama
  • Derivation
  • Naïve llama sdAb library
  • Type
  • Llama VHH
  • Specificity
  • Human PTH
  • Species Reactivity
  • Human
  • Clone
  • PTH22
  • Applications
  • Related Disease
  • Osteoporosis


  • Alternative Names
  • PTH1

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

See other products for "PTH"

* Abbreviations
3D IHC3D Immunohistochemistry
Cell ScreeningCell Screening
SeparationCell Separation
ChIPChromatin Immunoprecipitation
CMCDComplement Mediated Cell Depletion
DBDot Blot
EMElectron Microscopy
ELISAEnzyme-linked Immunosorbent Assay
ELISPOTEnzyme-linked Immunosorbent Spot
FCFlow Cytometry
FuncSFunctional Assay
GSGel Super Shift Assay
REImmunohistology - Resin Sections
IRMAImmunoradiometric Assay
SHIn situ hybridization
ICFCIntracellular Staining for Flow Cytometry
KO/KD-WBKnockout/Knockdown target confirmation by Western Blot
Live cell imagingLive cell imaging
CyTOF®Mass Cytometry
MeDIPMethylated DNA Immunoprecipitation
MultiplexMultiplex bead-based assay
PPProtein Purification
RIRadial Immunodiffusion
SPRSurface Plasmon Resonance
TCTissue Culture
WBWestern Blot

Send Inquiry

  • Verification code
    Click image to refresh the verification code.
© 2007 - 2020 Creative BioLabs All Rights Reserved
  • 0
  • 0
