Human Anti-TMCC3 Recombinant Antibody; Fab Fragment (TAB-700CT-F(E)) (CAT#: TAB-700CT-F(E))

This product is a recombinant Human antibody Fab fragment that recognizes TMCC3. The antibody was purified by affinity chromatography.


Specific Inquiry
  • Size:
  • Conjugation:
  • Endotoxin:
  • Purity:
  • Fc Engineering:
  • Gene Expression
  • Datasheet
  • MSDS
  • COA
Subcellular Location
Normal Tissue
RNA Expression

Specifications

  • Immunogen
  • TMCC3 (VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVI)
  • Host Species
  • Human
  • Type
  • Human Fab
  • Specificity
  • Human TMCC3
  • Species Reactivity
  • Human
  • Applications
  • ELISA, FC, WB, IHC
  • Related Disease
  • Breasr cancer, cervical cancer, prostate cancer, pancreatic cancer, lung cancer, glioblastoma, skin cancer,

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • TMCC3; transmembrane and coiled-coil domain family 3

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Downloads

Download resources about recombinant antibody development and antibody engineering to boost your research.

See other products for "TMCC3"

Human Antibody

CAT Product Name Application Type
TAB-699CT Human Anti-TMCC3 Recombinant Antibody (TAB-699CT) ELISA, FC, WB, IHC Human antibody
TAB-700CT Human Anti-TMCC3 Recombinant Antibody (TAB-700CT) ELISA, FC, WB, IHC Human antibody
TAB-701CT Human Anti-TMCC3 Recombinant Antibody (TAB-701CT) ELISA, FC, WB, IHC Human antibody
TAB-702CT Human Anti-TMCC3 Recombinant Antibody (TAB-702CT) ELISA, FC, WB, IHC Human antibody
TAB-699CT-S(P) Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-699CT-S(P)) ELISA, FC, WB, IHC Human scFv

Customer Reviews and Q&As

Submit a review or a question
There are currently no Customer reviews or questions for TAB-700CT-F(E). Click the button above to contact us or submit your feedback about this product.
View the frequently asked questions answered by Creative Biolabs Support.

For Research Use Only. Not For Clinical Use.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

© 2024 Creative Biolabs.
  • 0
  • 0
Cart

    Go to compare