Human Anti-TMCC3 Recombinant Antibody (TAB-700CT) (CAT#: TAB-700CT)
This product is a recombinant Human antibody that recognizes TMCC3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/105_F12_1_selected.jpg

(Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in glial cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/ihc_selected.jpg

(Glial cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Neuronal cells Staining: Low Intensity: Weak Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_B_9_5.jpg

(Glandular cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_3.jpg

(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_5.jpg

(Cells in seminiferous ducts Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_4_6.jpg

(Non-germinal center cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_8.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000057704-TMCC3
Specifications
- Immunogen
- TMCC3 (VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVI)
- Host Species
- Human
- Type
- Human antibody
- Specificity
- Human TMCC3
- Species Reactivity
- Human
- Applications
- ELISA, FC, WB, IHC
- Related Disease
- Breasr cancer, cervical cancer, prostate cancer, pancreatic cancer, lung cancer, glioblastoma, skin cancer,
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "TMCC3"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-699CT | Human Anti-TMCC3 Recombinant Antibody (TAB-699CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-701CT | Human Anti-TMCC3 Recombinant Antibody (TAB-701CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-702CT | Human Anti-TMCC3 Recombinant Antibody (TAB-702CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-699CT-F(E) | Human Anti-TMCC3 Recombinant Antibody; Fab Fragment (TAB-699CT-F(E)) | ELISA, FC, WB, IHC | Human Fab |
TAB-700CT-F(E) | Human Anti-TMCC3 Recombinant Antibody; Fab Fragment (TAB-700CT-F(E)) | ELISA, FC, WB, IHC | Human Fab |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for TAB-700CT. Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: WB, IP, IF, FuncS, FC, Neut, ELISA
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: WB, ELISA, FC, IP, FuncS, IF, Neut
Application: IF, IP, Neut, FuncS, ELISA, FC, ICC
Application: WB, IHC, FC, Cyt, ELISA
Application: WB, ELISA, FuncS
Application: WB, ELISA, FC, IHC, IP
Application: ELISA, FC
Application: ELISA, FC, IF, WB
Application: ELISA, IHC, FC, IP, IF, FuncS
Application: ELISA, IHC, IF, IP, FC, FuncS
Application: ELISA, FC, Neut, Inhib
Application: ELISA, WB
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.