Human Anti-TMCC3 Recombinant Antibody (TAB-699CT)

CAT#: TAB-699CT

This product is a recombinant Human antibody that recognizes TMCC3. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography.

Gene Expression
Figure 1 IF staining of human cell line U-251 MG Figure 2 IHC staining of human caudate Figure 3 Cerebral cortex Figure 4 Colon Figure 5 Kidney Figure 6 Testis Figure 7 Lymph node Figure 8 RNA cell line category: Cell line enhanced (HUVEC TERT2, Karpas-707, U-266/84)

Specifications

  • Immunogen
  • TMCC3 (VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVI)
  • Host Species
  • Human
  • Type
  • Human antibody
  • Specificity
  • Human TMCC3
  • Species Reactivity
  • Human
  • Applications
  • ELISA, FC, WB, IHC
  • Related Disease
  • Breasr cancer, cervical cancer, prostate cancer, pancreatic cancer, lung cancer, glioblastoma, skin cancer,

Product Property

  • Purity
  • >95% as determined by SDS-PAGE
  • Concentration
  • Please refer to the vial label for the specific concentration.
  • Buffer
  • PBS
  • Preservative
  • No preservatives
  • Storage
  • Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

  • Alternative Names
  • TMCC3; transmembrane and coiled-coil domain family 3
REVIEWS AND Q&AS CITATIONS RESOURCES DOWNLOADS RELATED PRODUCTS
Inquiry
Navs

Customer Review

Submit a review or a question

There are currently no Customer reviews or questions for TAB-699CT. Click the button above to contact us or submit your feedback about this product.
Breast cancer biomarkers at key points during disease progression
Reliable IHC Staining
The recombinant human antibody against TMCC3 performed very well in Immunohistochemistry. It specifically recognized the target in our cancer tissue samples. We appreciate that it is expressed in mammalian cells, ensuring proper folding and high specificity.
Breast cancer biomarkers at key points during disease progression
High Quality for ELISA
We used this antibody in ELISA to detect TMCC3 levels. The purity is consistently>95%, and it works well for our screening purposes. It is a robust tool for our research into transmembrane and coiled-coil domain family proteins.

Q&As

  1. How is this recombinant antibody produced?

    A: This product is a recombinant Human antibody expressed in mammalian cells using chemically defined culture media. It is subsequently purified by affinity chromatography to ensure high purity (>95% by SDS-PAGE) and consistency.

  2. What applications is this TMCC3 antibody compatible with?

    A: This recombinant antibody recognizes TMCC3 and has been validated for use in Enzyme-linked Immunosorbent Assay (ELISA), Flow Cytometry (FC), Western Blot (WB), and Immunohistochemistry (IHC), offering versatility for your experiments.

View the frequently asked questions answered by Creative Biolabs Support.

Submit Your Publication

Published with our product? Submit your paper and receive a 10% discount on your next order! Share your research to earn exclusive rewards.

Article title:
DOI/PubMed URL:
Email:
Name:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Downloadable Resources

Download resources about recombinant antibody development and antibody engineering to boost your research.

Product Notes

This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:

• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production

See more details about Hi-Affi™ recombinant antibody benefits.

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number:

Protocol & Troubleshooting

We have outlined the assay protocols, covering reagents, solutions, procedures, and troubleshooting tips for common issues in order to better assist clients in conducting experiments with our products. View the full list of Protocol & Troubleshooting.

See other products for "TMCC3"

Select a product category from the dropdown menu below to view related products.

CAT Product Name Application Type
TAB-700CT Human Anti-TMCC3 Recombinant Antibody (TAB-700CT) ELISA, FC, WB, IHC Human antibody
CAT Product Name Application Type
TAB-701CT Human Anti-TMCC3 Recombinant Antibody (TAB-701CT) ELISA, FC, WB, IHC Human antibody
CAT Product Name Application Type
TAB-702CT Human Anti-TMCC3 Recombinant Antibody (TAB-702CT) ELISA, FC, WB, IHC Human antibody
CAT Product Name Application Type
TAB-699CT-S(P) Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-699CT-S(P)) ELISA, FC, WB, IHC Human scFv
CAT Product Name Application Type
TAB-700CT-S(P) Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-700CT-S(P)) ELISA, FC, WB, IHC Human scFv
CAT Product Name Application Type
VS-0425-YC99 Recombinant Anti-TMCC3 Vesicular Antibody, EV Displayed (VS-0425-YC99) ELISA, FC, Cell-uptake
Specific Inquiry
Go to compare Add to compare

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Send Inquiry

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Go to compare

Go to compare

Merry Christmas & Happy New Year
Happy Thanksgiving close ad