Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-700CT-S(P)) (CAT#: TAB-700CT-S(P))
This product is a recombinant Human antibody scFv fragment that recognizes TMCC3. The antibody was purified by affinity chromatography.
We specialize in custom recombinant antibody production, offering seamless execution from provided sequences to high-quality antibody deliverables, ensuring optimal yield and purity.

(Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/105_F12_1_selected.jpg

(Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in glial cells.)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/ihc_selected.jpg

(Glial cells Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Neuronal cells Staining: Low Intensity: Weak Quantity:>75% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_B_9_5.jpg

(Glandular cells Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_3.jpg

(Cells in glomeruli Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous Cells in tubules Staining: Medium Intensity: Moderate Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_5.jpg

(Cells in seminiferous ducts Staining: Medium Intensity: Moderate Quantity:>75% Location: Cytoplasmic/ membranous Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_4_6.jpg

(Non-germinal center cells Staining: Low Intensity: Weak Quantity: 75%-25% Location: Cytoplasmic/ membranous)
* Image credit: Human Protein Atlas v21.proteinatlas.org/images/14272/32510_A_7_8.jpg

(Cell lines ordered by descending RNA expression order)
* Image credit: Human Protein Atlas v21.proteinatlas.org/ENSG00000057704-TMCC3
Specifications
- Immunogen
- TMCC3 (VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVI)
- Host Species
- Human
- Type
- Human scFv
- Specificity
- Human TMCC3
- Species Reactivity
- Human
- Applications
- ELISA, FC, WB, IHC
- Related Disease
- Breasr cancer, cervical cancer, prostate cancer, pancreatic cancer, lung cancer, glioblastoma, skin cancer,
Product Property
- Purity
- >95% as determined by SDS-PAGE
- Concentration
- Please refer to the vial label for the specific concentration.
- Buffer
- PBS
- Preservative
- No preservatives
- Storage
- Centrifuge briefly prior to opening vial. Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Target
Product Notes
This is a product of Creative Biolabs' Hi-Affi™ recombinant antibody portfolio, which has several benefits including:
• Increased sensitivity
• Confirmed specificity
• High repeatability
• Excellent batch-to-batch consistency
• Sustainable supply
• Animal-free production
See more details about Hi-Affi™ recombinant antibody benefits.
Downloads
Download resources about recombinant antibody development and antibody engineering to boost your research.
See other products for "TMCC3"
Select a product category from the dropdown menu below to view related products.
CAT | Product Name | Application | Type |
---|---|---|---|
TAB-699CT | Human Anti-TMCC3 Recombinant Antibody (TAB-699CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-700CT | Human Anti-TMCC3 Recombinant Antibody (TAB-700CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-701CT | Human Anti-TMCC3 Recombinant Antibody (TAB-701CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-702CT | Human Anti-TMCC3 Recombinant Antibody (TAB-702CT) | ELISA, FC, WB, IHC | Human antibody |
TAB-699CT-S(P) | Human Anti-TMCC3 Recombinant Antibody; scFv Fragment (TAB-699CT-S(P)) | ELISA, FC, WB, IHC | Human scFv |
Customer Reviews and Q&As
There are currently no Customer reviews or questions for TAB-700CT-S(P). Click the button above to contact us or submit your feedback about this product.
Popular products with customers
Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
Application: ELISA, FC, IP, FuncS, IF, Neut, ICC
Application: ELISA, IHC
Application: Neut, ELISA, IF, IP, FuncS, FC, ICC
Application: Neut, ELISA, Inhib, ICC, WB
Application: ELISA, Inhib, FC
Application: ELISA, IHC, FC, IP, IF, Inhib
Application: ELISA, IHC, FC, IP, IF, BL
Application: FC, FuncS, IA, IF, IP, IHC
Application: ELISA, FC, WB, Inhib, IHC
Application: Neut, FuncS, IHC, ELISA, FC, Inhib
For Research Use Only. Not For Clinical Use.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.